KEGG   Winogradskyella sp. PG-2: WPG_2966Help
Entry
WPG_2966          CDS       T03603                                 

Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
win  Winogradskyella sp. PG-2
Pathway
win00260  Glycine, serine and threonine metabolism
win01100  Metabolic pathways
win01110  Biosynthesis of secondary metabolites
win01120  Microbial metabolism in diverse environments
win01130  Biosynthesis of antibiotics
win01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:win00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WPG_2966
Enzymes [BR:win01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     WPG_2966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_3 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: BAO77196
UniProt: A0A024FJT0
Position
3204865..3205884
Genome map
AA seq 339 aa AA seqDB search
MIIDLRSDTVTKPTKGMLKAMLTAEVGDDVYKEDPSVNALEKRLADMFGMDEALFFPTGS
MANQAALKLHTNPGEQVICDKYAHIYNYEGGGASFNSGISCKLIDGYRGMFTAKQAKASI
NPPDFYHSPLTSLIAIENTTNKGGGACWDFKELEKIRTVADENSLGYHLDGARLWNALSN
TNENPKHYGELFDTISVCLSKGLGCPMGSILIGNKNVMNGALRVRKILGGGMRQVGFAAA
AGLYALDNHFERLSEDHQKAKEIGEALSELGSIKKVEPIETNIIIFELNNDIDEISFLAD
LNKSDIHIIGMGSNKLRMVTHLDYTDAMHEKLISVLKTM
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgataatagatttaagaagcgatacagttacaaaaccaacaaaaggcatgttaaaagct
atgttaacagctgaagttggtgatgatgtatataaagaagatccttcggttaatgcttta
gaaaaacgattagccgatatgtttggaatggatgaggctttattttttccaacaggaagt
atggctaatcaggcagctttaaaactacatacaaatcctggagaacaagtaatttgtgat
aagtatgcacatatctataattatgaaggaggtggtgcttcgtttaatagcggaatctct
tgcaaattaattgatggatatcgtggtatgttcaccgcaaaacaagctaaagcatctata
aatccgccagatttttaccatagtccgttaacctcattgatagccattgagaataccact
aataaaggaggtggtgcgtgttgggactttaaagaattagaaaaaattagaaccgttgct
gatgaaaatagtttaggttatcatttagatggtgcacgactgtggaatgcactcagcaac
acaaacgaaaatcctaaacattatggtgagctatttgatactatttcagtttgcttaagc
aaaggtttgggctgcccaatgggttctattttaataggtaataaaaatgtaatgaacgga
gcacttagagtccgaaaaatattaggaggtggtatgcggcaagttggttttgcagcagca
gcaggattatatgctttggataaccattttgaaagactttctgaagatcatcaaaaagct
aaagaaataggtgaggcgttaagtgaattaggctcaattaagaaagtagaacctatagaa
acaaatattatcatctttgaattgaataatgatattgacgaaatcagctttttagctgat
ttaaataagtcggatattcacataattggtatgggaagcaacaaattaagaatggtaacg
catctagattatacagatgctatgcacgagaaacttattagtgttttaaaaacaatgtaa

DBGET integrated database retrieval system