KEGG   Weissella jogaejeotgali: FOL01_0020Help
Entry
FOL01_0020        CDS       T04632                                 

Definition
(GenBank) Hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
wjo  Weissella jogaejeotgali
Pathway
wjo00900  Terpenoid backbone biosynthesis
wjo01110  Biosynthesis of secondary metabolites
wjo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:wjo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FOL01_0020
Enzymes [BR:wjo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     FOL01_0020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red LytR_C
Motif
Other DBs
NCBI-ProteinID: APS40879
UniProt: A0A1L6R8K7
Position
24378..25643
Genome map
AA seq 421 aa AA seqDB search
MANWHSFYKRPWSERLTILTNNQNLTTAEQQLMQNSYDHIGAQQVENYIYNFGVPTGLLL
QLPVNGREMIVPMTTEEPSVIAAANNGARMMRYGSGVKTKRQERLMRGQIIIVNLSDIAS
LQRLVQNHMTELLQIANDAHPSMAARGGGAKRLTVDVLDETTVAVNVLVDTKEAMGANTV
NTMAEAVATQLRQKGYQVLMAILSNYGTESLVEAEVAIPVTALATKQGLPGQVVAEKIAA
ASHMEELSPHRAVTANKGILNGIEAVVLASGNDTRAVNAALHAYAAHNGQYSGLISWQVV
DDQLIGRTVMPMSVGVVGGSIGIVPAVKLNHHIMDNPNAQQLASIIIATGLAQNLAALRA
LVSTGIQAGHMALQAKSLAIQVGAKDNEVDLLVARLKQSSQINASMAQQLLQEMRHANAE
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcaaattggcatagtttttataaacgtccatggtcagaacgtttaaccattttgacc
aataatcaaaatttaacaactgcagaacaacaattgatgcaaaatagttatgatcatatt
ggtgcccaacaagtagaaaattatatctataattttggtgtgccaacgggtttattattg
caattaccggtcaacggacgggaaatgattgtgccaatgacaactgaggaacccagtgtg
attgctgcagccaataatggtgcccgtatgatgcggtacggtagtggtgtgaagaccaag
cgacaagaacgcttaatgcgcggtcaaattatcattgttaatctttcagatattgcaagt
ttacaaaggttagtccagaaccatatgaccgagttgttgcaaatcgccaatgatgcccat
ccatcgatggcagctcgtggtggtggcgccaagcgattaacggttgatgtgctggatgaa
accacggtcgcagtcaacgtattagtggatactaaagaagccatgggggcaaatacagtc
aacacaatggcagaggcggtggcgacacaattacgccagaaagggtatcaagtcttgatg
gcgatcctatctaattatggtaccgaatcgttagttgaggcagaagtggccattccggtg
acggcattagcaacgaaacaagggctacctggccaggtggttgccgaaaaaattgctgca
gcaagtcacatggaagaattatcaccacatcgtgcggtcaccgctaataaaggtattttg
aatggtattgaagcagttgtacttgcaagtggtaatgatacaagggctgtgaatgctgct
ttgcatgcttatgctgctcataatggccaatatagtggtttaatttcatggcaagttgtc
gatgatcaattaattggtcggacagtaatgccaatgtcagttggtgtcgttggtggctcg
attggtatcgtgccagcagtaaagctaaaccatcatattatggataatccgaatgctcag
caattggcaagcattatcattgcgacaggattggctcagaacctggcagcgttgcgcgca
ttagtgtcaacaggcattcaggcaggccatatggctttacaggcaaaatcgctggcaatc
caggttggcgccaaggataatgaggtcgacctattagttgcacgattaaaacagtcatca
caaataaacgcatcaatggcacagcaattgttacaggaaatgcggcatgcaaatgcagaa
caataa

DBGET integrated database retrieval system