KEGG   Weissella jogaejeotgali: FOL01_0248Help
Entry
FOL01_0248        CDS       T04632                                 

Definition
(GenBank) Glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
wjo  Weissella jogaejeotgali
Pathway
wjo00480  Glutathione metabolism
wjo00590  Arachidonic acid metabolism
wjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wjo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    FOL01_0248
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FOL01_0248
Enzymes [BR:wjo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FOL01_0248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: APS41107
UniProt: A0A1L6R986
Position
256304..256780
Genome map
AA seq 158 aa AA seqDB search
MTSIYDFSETEMNGKEINLKDYAGKVVIIVNTASKCGLAPQLEGLESLYQKYRDDGLVVL
GLPSNQFKQELDTDEETSDYCQVHYGVTFPMTKRVLVNGDDEDGLFTYLKYMSGNGPIKW
NYTKFLVGRDGQLIHRYAPITKPEKMEKEIAAALKIKA
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaatttatgatttttcggaaacggaaatgaacggtaaagaaattaacttaaaa
gattacgctggtaaagttgtgatcattgttaatacagctagtaaatgtggattagcccca
caacttgaagggttagaatctctctatcaaaaatatcgggatgatggcttggttgtatta
ggattaccatcaaatcaatttaaacaagaattagatacggatgaggagactagtgattat
tgccaagtgcattatggtgtaactttccctatgaccaagcgtgtgctggttaatggtgac
gatgaagatggattgtttacgtatttaaaatatatgtcaggaaatggtccgataaagtgg
aactacactaagtttttggtgggtcgcgatgggcaactcattcatcgctatgcaccaatt
actaaacctgaaaagatggaaaaagaaattgctgcggcattaaaaatcaaggcataa

DBGET integrated database retrieval system