KEGG   Weissella jogaejeotgali: FOL01_0249Help
Entry
FOL01_0249        CDS       T04632                                 

Definition
(GenBank) Threonine dehydrogenase and related Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
wjo  Weissella jogaejeotgali
Pathway
wjo00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:wjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FOL01_0249
Enzymes [BR:wjo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     FOL01_0249
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     FOL01_0249
    1.1.1.-  
     FOL01_0249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 ADH_N_assoc Glu_dehyd_C 2-Hacid_dh_C PALP UDPG_MGDP_dh_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: APS41108
UniProt: A0A1L6R9C4
Position
257051..258103
Genome map
AA seq 350 aa AA seqDB search
MKAAVWHGVKDIRVEDVDLKPAKDDEVVIRVAYAGICGSDLHEYLEGPVFIPVDKVDELT
GGEAPVTMGHEFSGVIESVGKDVKNYKVGDHVSVNPTVTHGESPDDVDVYDGYSFIGLSC
NGGFAAHVNVPEGNLYSLPEEFPLKLAATIEPTAVAVQAVKEGGLKFGEKVAIFGAGPIG
VLVAAAAKAAGATKIVAVDLSAVRLEKALAMGATDVVNPSEVDDAVATVREILGGGADVS
FEVAGVQPTFEQAIDVTKARGTAVIVSIFAHPISFDPMQLMNAGVKLTSTIAYSRETFQQ
TVDLVSSGQINVEPVITDIIGLDDVVEKGFDRLSTDKSQAKILIDLTKEN
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcagtatggcatggcgtaaaggatattcgtgttgaagatgtagacttgaaa
ccagcaaaagatgatgaagtcgttattcgtgtggcatatgccggaatctgtggtagtgac
ttgcacgaatacttagagggtcctgtatttattccggttgataaggttgacgaattaact
ggtggtgaagcaccagttactatgggacatgaattctcaggtgtcattgagtcagttggt
aaggatgttaaaaattataaagtcggtgatcatgtttcagttaatccaacggttacacat
ggggaatcaccagatgacgtcgatgtttatgatggttatagctttattggtttgagctgt
aatggtggtttcgctgcgcatgttaatgtgccagagggcaacttatattcattaccagaa
gagttcccactaaagttggctgctacgattgagccaactgccgttgctgtacaagctgtt
aaagagggtggcttgaagtttggtgagaaggttgccatctttggtgctggaccaattggt
gtgttagttgccgctgctgctaaggctgctggtgcaactaagattgtggcagttgatcta
tcggctgttcgtttggaaaaggcattggcgatgggagcaactgatgttgtaaaccctagt
gaagttgatgacgcagttgcaactgtccgtgaaattttaggtggcggcgcagacgtatca
ttcgaagttgctggtgtacaacctacttttgaacaagcaattgatgtgacaaaggctcgt
ggaacagcagtgattgtttcaatctttgcccacccaatctcatttgatccaatgcaatta
atgaatgctggtgttaagttgacatcaaccattgcatactcacgtgagaccttccaacaa
actgttgacctagttagctcaggtcagattaatgttgagccagttattacagatatcatt
ggtttggatgacgttgttgaaaaaggatttgatcgcttatcaacagacaagtcacaagct
aagattttgattgacttgactaaagaaaattaa

DBGET integrated database retrieval system