KEGG   Weissella jogaejeotgali: FOL01_1720Help
Entry
FOL01_1720        CDS       T04632                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
wjo  Weissella jogaejeotgali
Pathway
wjo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:wjo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FOL01_1720
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:wjo03011]
    FOL01_1720
Ribosome [BR:wjo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FOL01_1720
  Bacteria
    FOL01_1720
  Archaea
    FOL01_1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: APS42579
UniProt: A0A1L6RDE0
Position
complement(1809913..1810260)
Genome map
AA seq 115 aa AA seqDB search
MAEQITSARATAKLVRVAPRKVRQVLDQVRGKSVAEAFAILQFLPNHSSENVYKVLNSAV
ANAENNFSLDREDLVVAEAFANEGPTLKRFRPRAKGSASPINKRTSHITIVVKEK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaaatcacgtcagcacgcgccacggccaaactcgttcgtgtcgctccacgt
aaggtccgccaagtgcttgaccaagttcgtggtaagtctgtggctgaggcatttgcaatt
ttgcaattcttgccaaaccacagctcagaaaatgtatacaaagtgttgaactcagcagta
gcaaacgctgagaacaacttctcattagatcgcgaagatttggtagtggctgaagccttt
gcaaacgaaggaccaacgctaaagcgtttccgtccacgtgctaagggatcagcttcacca
atcaacaagcgtacaagccacattactattgtggtaaaagaaaagtaa

DBGET integrated database retrieval system