KEGG   Weissella koreensis: WKK_00345Help
Entry
WKK_00345         CDS       T01577                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
wko  Weissella koreensis
Pathway
wko00230  Purine metabolism
wko00240  Pyrimidine metabolism
wko01100  Metabolic pathways
wko01110  Biosynthesis of secondary metabolites
wko01130  Biosynthesis of antibiotics
Module
wko_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
wko_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:wko00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    WKK_00345
   00240 Pyrimidine metabolism
    WKK_00345
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:wko04131]
    WKK_00345
Enzymes [BR:wko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     WKK_00345
Membrane trafficking [BR:wko04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    WKK_00345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AEJ22945
UniProt: F8HXW9
Position
complement(72945..73370)
Genome map
AA seq 141 aa AA seqDB search
MTERTLAIVKPDGVIQKKVGEIIRRIERKGYDIIDIKMVQADEALLRAHYAELADRPFFP
GLMHYMMEHPVVAIVVEGDNVIKGWRTLMGLTNPTEAAPGTIRGDFGRDWPGDEVRNVVH
GSDSPESAQHEIKLWFPELNN
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacgtacattagcaattgttaaaccagatggtgtcatccaaaaaaaagtgggt
gaaattattcggcgaattgagcgtaaaggctatgatattatcgatatcaaaatggtacaa
gctgatgaagctttgttaagggctcattatgctgaattagccgatcggccctttttccct
ggattaatgcattatatgatggagcaccctgtggttgccattgtagtggaaggggataac
gttattaaaggatggcgtactttgatgggccttactaatcccactgaagctgctcctgga
acgatccgcggtgattttggacgtgactggccaggtgatgaagtgcgtaacgttgttcac
ggttctgattctccagaaagtgctcaacacgaaataaagctatggttccccgaattaaat
aattaa

DBGET integrated database retrieval system