KEGG   Weissella koreensis: WKK_02165Help
Entry
WKK_02165         CDS       T01577                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
wko  Weissella koreensis
Pathway
wko00230  Purine metabolism
wko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    WKK_02165
Enzymes [BR:wko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     WKK_02165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 Thymidylate_kin MMR_HSR1 AAA_28 AAA_33 AAA_16 AAA_30 DUF2075 AAA_25 T2SSE AAA ABC_tran ADK AAA_14 SRP54 AAA_5 TsaE dNK AAA_24 CoaE SKI Cytidylate_kin2 Zeta_toxin Sigma54_activat AAA_17 Sigma54_activ_2 Torsin PhoH AAA_19 ATPase_2 AAA_26 RNA_helicase IPT NACHT NTPase_1 ATPase ResIII
Motif
Other DBs
NCBI-ProteinID: AEJ23307
UniProt: F8I175
Position
complement(438918..439487)
Genome map
AA seq 189 aa AA seqDB search
MTNEEAQKVLVITGNTGTGKTTVARYLAEKYHFPQVVTHTTRPPRAGEADGQDYYFETEA
SFPKNHYLEQVVYSNYHYGSSYEGLNRAWEKNSLITIVLDTAGALTYAQQLGSKVEVLYL
SVENAADLTQRLIDRGDQLERIQKRIQSAEFIRDLSVPDALKQYAHMIINNNWVKTQKEI
DRIIKNMLK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgaagaagcgcaaaaagttttagtaattacgggaaatactgggacagggaaa
acgacggtagcacggtacttagcagaaaaatatcattttcctcaggtggtaacgcacact
acacgaccaccacgagcaggtgaagccgatggacaagattattattttgagacggaggct
agttttcctaaaaatcattatttagagcaggtagtctatagtaattatcattatggttct
tcatacgaaggcttgaatcgggcttgggagaaaaactcattaattacgattgttttagac
acagcgggagctttgacttatgcacaacaattgggatcaaaggttgaggtgctctatcta
tcagttgagaatgcggcggatttaacacaacgattgattgatcggggagaccagttagag
cggattcaaaagcggatacaaagtgctgaatttattcgagatttatcagtccctgatgca
ttaaaacaatatgcgcatatgattattaataataattgggtaaaaacgcaaaaagaaatc
gaccgaattattaaaaatatgctaaaataa

DBGET integrated database retrieval system