KEGG   Weissella koreensis: WKK_02580Help
Entry
WKK_02580         CDS       T01577                                 

Definition
(GenBank) ethanol-active dehydrogenase/acetaldehyde-active reductase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
wko  Weissella koreensis
Pathway
wko00010  Glycolysis / Gluconeogenesis
wko00071  Fatty acid degradation
wko00625  Chloroalkane and chloroalkene degradation
wko00626  Naphthalene degradation
wko01100  Metabolic pathways
wko01110  Biosynthesis of secondary metabolites
wko01120  Microbial metabolism in diverse environments
wko01130  Biosynthesis of antibiotics
wko01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WKK_02580
  Lipid metabolism
   00071 Fatty acid degradation
    WKK_02580
  Amino acid metabolism
   00350 Tyrosine metabolism
    WKK_02580
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    WKK_02580
   00626 Naphthalene degradation
    WKK_02580
Enzymes [BR:wko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     WKK_02580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 MTS
Motif
Other DBs
NCBI-ProteinID: AEJ23390
UniProt: F8HYX9
Position
complement(539485..540537)
Genome map
AA seq 350 aa AA seqDB search
MKAAVVRENNDGYVDLIDDWEPRSLAFGEALVDVEYVGICHTDLHVAAGDFGDPNKMGTQ
NGKFRRVIGHEGVGRVSKLGEGASDYLKLGDRVSIAWFYDACGVCDYCVSGNETFCRNAR
NSGYTVDGAMAQQCVVNAKYAVKVPEGLDPVQATSITCAGVTMYKSLKVGETKPGQWVSV
HGAGGLGNLAVQYAHNVFGAHVAVIDGNDDKLEAARLNGAEVLVNRKKEDVVARVNELTG
GVHNAQVTAVNDAAFSQAVNVLRPMGKLVAVALPQGDMSLNIAKTVLDGIEVRGSLVGTR
ADLKEAFQFGAEGKVTPIVEKVPFSEINSVIDEMKQGSITGRKVIDFTTL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagttgttcgcgaaaataatgatggatatgttgatttgattgatgactgg
gaaccacgttccttggcatttggagaagcgctagttgacgtagaatatgtaggtatttgt
catactgatttgcatgttgctgctggagattttggtgatcctaataagatgggaactcaa
aacggtaaattccgtcgggttattggtcatgaaggagtcggtcgagtatctaagcttggt
gaaggtgcaagtgattatttgaagcttggtgatcgtgtttcaattgcctggttctatgat
gcttgtggagtttgtgattactgtgtttctggaaatgaaactttctgccgtaatgctcgt
aactcaggttatacagttgatggtgcaatggctcaacaatgtgtggttaatgctaagtat
gctgttaaagttcctgagggacttgatccagttcaagcaacatcaattacttgtgccgga
gtgacaatgtataagtcattaaaggttggggaaacaaagccaggacaatgggtttctgtc
catggggctggaggtctaggaaacttggccgttcaatatgcacataacgtctttggagct
catgttgccgttattgatggaaacgatgataaacttgaagccgctcgccttaacggagcc
gaagttttggttaaccgtaagaaagaggatgttgtcgctcgtgtgaatgaactaactggt
ggtgttcacaatgctcaagtgacagcagttaacgatgcagcattctcacaggcggtcaat
gttttacgtccaatgggtaagttggttgcagttgcgttaccacaaggtgatatgtctttg
aatattgctaagaccgtcttagatggaattgaagtgcgcggatcactagttggaacgcgt
gctgatttgaaagaagccttccaatttggggctgaaggtaaagttaccccaatcgttgaa
aaagttccattctcagaaatcaattctgttattgatgaaatgaagcaaggatcaattact
ggacgtaaggtaattgactttactactttgtaa

DBGET integrated database retrieval system