KEGG   Weissella koreensis: WKK_02975Help
Entry
WKK_02975         CDS       T01577                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
wko  Weissella koreensis
Pathway
wko00030  Pentose phosphate pathway
wko00480  Glutathione metabolism
wko01100  Metabolic pathways
wko01110  Biosynthesis of secondary metabolites
wko01120  Microbial metabolism in diverse environments
wko01130  Biosynthesis of antibiotics
wko01200  Carbon metabolism
Module
wko_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:wko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    WKK_02975
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    WKK_02975
Enzymes [BR:wko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     WKK_02975
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     WKK_02975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 ApbA Shikimate_DH 3HCDH_N NAD_Gly3P_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEJ23469
UniProt: F8HZT2
Position
complement(604083..605510)
Genome map
AA seq 475 aa AA seqDB search
MEQANFGVVGLAVMGRNLALNVESRGYTVAVYNRSRTRTDDLVAKHAEKHFVPSYTVEDF
VKSIERPRRILLMVKAGAGTDAVIEELLPFLEKDDILIDGGNTFFEDTMRRSEYLAASGI
NFIGMGVSGGELGALEGPSMMPGGQKEAYDLVEPILHEIAAKAPEDGKPTVTYIGPDGAG
HYVKMVHNGIEYGDMQLIAESYDILKRVVGLSQTDLADTFKEWNAGELDSYLIEITADIL
TRKDDLGSDKPMVDMILDRAGNKGTGKWSSQSALEVGAPQSLITESVYARYISAMKDDRV
AASKELNGPDYQFEGDLKATVEDLRQALYFGKIMSYAQGFDQLRMASDHYDWNLPFGELA
QLWRAGAIIRARFLQRITDAYDADPALHNLLLNDYFKTIAEKYQGAARRVVALAVEAGIP
APSLSAAVAYYDSYRSAVLPANLIQAQRDYFGAHTYERVDQPAGKMYHYSWYDEA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggaacaagctaattttggtgtagttggtttagctgtaatgggtcgtaatttggcttta
aacgttgaatcaagaggttatacggttgcagtttacaaccgttcacgcacacggacggat
gatttggtagcaaagcatgctgaaaagcattttgttccaagttataccgttgaagatttt
gttaaatcaatcgaacgcccccgacgaattttgttgatggtcaaggctggggctggaaca
gatgctgtcatcgaagaattgttaccatttttggaaaaagatgatatcttgatcgatggt
gggaatacattctttgaagatacaatgcgccgttctgaatatttggcggcatctggaatt
aacttcatcggaatgggtgtttctggtggagaattaggggccttagaaggaccctcaatg
atgcctggtggtcaaaaggaagcttatgacctagtagaaccaattttgcatgaaattgcg
gccaaggcacctgaagatggaaagcctacagtaacttacattggaccagatggtgcaggg
cattatgttaaaatggtgcacaatggaattgagtatggagatatgcaattaattgctgaa
tcatatgatattttaaaacgtgtagttggtttgtcacaaactgatttagcagataccttt
aaagaatggaatgctggagaacttgattcatatttgatcgagattacagctgacattttg
acgcgaaaagatgatcttggtagtgataagccaatggttgatatgatcttggaccgtgct
ggtaacaagggaactggaaagtggtcttcacaatcagctttggaagttggggcacctcaa
tcattaatcactgaatcagtttatgcgcgttacatttctgcaatgaaggatgatcgtgtt
gctgcttcaaaggaactaaatggccctgattatcaatttgaaggtgatctaaaggcaaca
gttgaagacttacgtcaagctttgtatttcggaaagattatgtcttatgctcaaggattt
gatcaattgcgtatggcatcagaccactatgattggaatttgccatttggtgaattagct
caattatggcgtgccggtgcaattattcgggcgcgcttcttgcaacggattacagatgca
tatgatgctgatccagcattgcataatcttttgttgaatgactactttaagacgattgcc
gaaaagtatcaaggagctgctcgacgggttgtggctttggcagtggaagctggaattcca
gcaccatcactttcagccgcagtagcttattacgattcatatcgttcagccgttttgcca
gcaaacttaatccaagcacaacgggattactttggagcacacacatatgaacgagtagac
caaccagcaggtaaaatgtatcattatagctggtatgacgaagcctag

DBGET integrated database retrieval system