KEGG   Weissella koreensis: WKK_04880Help
Entry
WKK_04880         CDS       T01577                                 

Definition
(GenBank) HAD family sugar phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
wko  Weissella koreensis
Pathway
wko00627  Aminobenzoate degradation
wko01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:wko00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    WKK_04880
Enzymes [BR:wko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     WKK_04880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AEJ23848
UniProt: F8I016
Position
1034068..1034838
Genome map
AA seq 256 aa AA seqDB search
MAYKGYFIDLDGTIYQGKKSFPSGKRFIERLKAANKQFMFVTNNATRTPEQVQATLADGH
DIHVDLDQIYTSAMATADYVAQLPNVHQVLVVGENGLHQALASKGLKIVTQGLADAVVVG
LNRNLKYDDLMYATLAIQQGAKFIATNIDTNLPNEKGMIPGAGSVVASVQTSTQVDPIVI
GKPYTPIMEGALERAGLTVNDVVMVGDNYNTDIKAGINLKMDTLLVYSGISTKEQITAAQ
IKPTHEVDSLDDWFIE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcatataaaggatattttattgatttagatggaacaatttatcaaggtaaaaagagc
tttcctagtggaaaacgatttattgaacgtttaaaagctgctaataagcaatttatgttt
gtgaccaataatgctactagaacaccagagcaggtccaagctacactagcagatgggcac
gatattcatgtagatttggatcaaatttacacttcagctatggctactgctgattatgta
gcacaattaccaaatgtgcatcaagtattagtggttggtgaaaatggtctgcatcaagca
ttggcatcaaagggattgaagattgttactcaaggtttggcagatgcggtggttgtggga
ttaaatcgtaacttgaaatatgatgatttaatgtacgccactttggctattcaacaaggg
gcaaaatttatcgccacaaacattgatactaatttacctaatgaaaaggggatgattcca
ggtgcaggatcagttgtggcatcagtgcaaacatcaacacaagtggatccaatcgtgatt
ggtaaaccttatactcccattatggaaggtgctttggagcgtgcaggtttgactgtgaat
gatgtggtaatggttggtgataattataataccgatattaaagctggaattaatttgaag
atggacacgttgttagtatatagtggaatttcaacgaaagaacaaattactgcagcgcaa
attaagccaactcatgaagttgattctttggatgattggtttattgagtga

DBGET integrated database retrieval system