KEGG   Weissella koreensis: WKK_05715Help
Entry
WKK_05715         CDS       T01577                                 

Definition
(GenBank) 3-hydroxy-3-methylglutaryl CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
wko  Weissella koreensis
Pathway
wko00072  Synthesis and degradation of ketone bodies
wko00280  Valine, leucine and isoleucine degradation
wko00650  Butanoate metabolism
wko00900  Terpenoid backbone biosynthesis
wko01100  Metabolic pathways
wko01110  Biosynthesis of secondary metabolites
wko01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:wko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    WKK_05715
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    WKK_05715
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WKK_05715
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WKK_05715
Enzymes [BR:wko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     WKK_05715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Chal_sti_synt_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEJ24013
UniProt: F8I1I1
Position
1205023..1206186
Genome map
AA seq 387 aa AA seqDB search
MQVGIDQISFFSPNYYIDMVDLAMAREQDPNKYLIGIGQTQQAVIPPTQDAVTMAANAAE
SILTDTDREQLDLIIFATESGVDNSKSAAAYLQRLLGIQSYARTIEIKQACYAGTYGLMQ
ARDYVELNPNKKVLVVASDIARYGLGTSGEVTQGGGAVAMLVTANPRIMTLERDNQFMTK
EVMDFWRPVYATEARVDGKFSNDVYQSFFVELWDRYRHITGKDINDFKAFVFHLPYTKLG
LKGLRKILPEADEAKQISLLEQFEASRVDNKNIGNLYTGSLYLSLLSLLNHSHDLIAGDR
IGLFSYGSGAEGEFYSGIIQENYQEALVTDQMENILSNRTKLSILEYETMFNSALMGADD
RQLDGTKDPAKYILTGLREERRQYEQH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttggaattgatcaaattagtttcttttcaccaaattattatattgatatggtt
gatttggccatggcaagagagcaagaccccaataaatatttaattgggattggtcagact
caacaagcagtaataccaccaacacaagatgctgtaacaatggctgctaatgcagctgaa
tctattttaacagacacagatcgggagcaacttgatttaattatttttgctaccgaatct
ggagtggataattcaaaatcagctgctgcttatttacaacgtctattaggaattcaatca
tatgctcgaacaattgaaattaaacaagcttgttatgctggaacatatggattaatgcaa
gctcgtgattatgtggaattaaatcctaataaaaaagtcttagtagtagcaagtgatatt
gctcgttatgggcttggaactagtggtgaagtgacgcagggtggtggtgcagtagcaatg
ttagttacggctaacccacgaattatgactttagaacgtgataatcaatttatgactaaa
gaagtaatggatttttggcggccagtttatgccacagaagcgcgagttgacggtaaattt
tcaaacgatgtttatcaatcattctttgtggaattatgggaccgttaccgccatataaca
ggtaaagatattaatgattttaaagcctttgtctttcatttgccatacactaaattgggc
ttaaaaggattgcgtaaaattttgccagaagcggatgaagccaagcaaattagcctcttg
gaacaatttgaagcgagccgtgtagataataagaatattggtaatttgtacactggttca
ttgtatcttagtctgctttcattattgaatcatagtcatgacttgattgctggtgatcga
atcggattattttcatatggatcaggggctgaaggagaattttactctggtattattcaa
gaaaactatcaagaagctttggttacggatcaaatggaaaatattttatcaaatcgaact
aagctatcaattctagaatatgaaacaatgtttaatagcgctttaatgggcgcagatgat
cgacaattggatgggactaaagatcctgctaaatatattttaacgggtctaagagaagag
cgacgccaatacgagcagcattga

DBGET integrated database retrieval system