KEGG   Weissella koreensis: WKK_06520Help
Entry
WKK_06520         CDS       T01577                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
wko  Weissella koreensis
Pathway
wko00071  Fatty acid degradation
wko00072  Synthesis and degradation of ketone bodies
wko00280  Valine, leucine and isoleucine degradation
wko00362  Benzoate degradation
wko00620  Pyruvate metabolism
wko00630  Glyoxylate and dicarboxylate metabolism
wko00640  Propanoate metabolism
wko00650  Butanoate metabolism
wko00900  Terpenoid backbone biosynthesis
wko01100  Metabolic pathways
wko01110  Biosynthesis of secondary metabolites
wko01120  Microbial metabolism in diverse environments
wko01130  Biosynthesis of antibiotics
wko01200  Carbon metabolism
wko01212  Fatty acid metabolism
wko02020  Two-component system
Brite
KEGG Orthology (KO) [BR:wko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WKK_06520
   00630 Glyoxylate and dicarboxylate metabolism
    WKK_06520
   00640 Propanoate metabolism
    WKK_06520
   00650 Butanoate metabolism
    WKK_06520
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WKK_06520
   00072 Synthesis and degradation of ketone bodies
    WKK_06520
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WKK_06520
   00310 Lysine degradation
    WKK_06520
   00380 Tryptophan metabolism
    WKK_06520
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WKK_06520
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WKK_06520
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WKK_06520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:wko04147]
    WKK_06520
Enzymes [BR:wko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WKK_06520
Exosome [BR:wko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WKK_06520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AEJ24174
UniProt: F8HZG7
Position
1375690..1376874
Genome map
AA seq 394 aa AA seqDB search
MERVYIIGAKRTPIGKFGGTLSSLTASDLGSFVIKGALDQSGLEADQVSQVLMGNVVQAG
QGQNPARQAALKAGLPIQVPSITINDVCGSGLSSINMGAALIQAHQADIVVAGGMESMSK
APYIVDQARFGARLGDGRMIDALLSDALTDAQGGYHMGITAENVAKKYDISREEMDEFSY
QSHQRAVSAQDKHRFDDEIVSLPMIDRKGNSYVVDQDEAPRRDTSLEKLAKLKPVYQEDG
AVTAGNASGLNDGAAAVVLISESKMHELGIEPLAQWQASALVGLEPELMGIGSYYAVEKL
FKDHPDFKQSEVDYFELNEAFAAPSLVVGDQLLGLDPAIVNPNGGAIALGHPVGASGSRI
LVTLIYELIHDDKKTGVAALCVGGGMGVSALITR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggagcgagtttatattattggggcaaaacgaaccccaattggtaagtttggaggcaca
ttgtcttccttaacggcctcggatttaggctcatttgtaattaaaggagctttagatcaa
tcaggtttagaggctgatcaagttagtcaagtcttgatggggaatgtagtccaagcgggt
caaggtcaaaatccggctcgtcaagctgctttaaaggccggacttccgatccaagtacca
tcaataacgattaatgatgtgtgtggatcaggactatccagcatcaatatgggcgcagct
ttaattcaagcacaccaagcagatatcgttgttgctggggggatggaaagtatgtctaaa
gccccttatattgtcgatcaagcccgttttggagcccgtttgggtgatggtaggatgatt
gatgccttattgtcggatgctttgactgacgctcaaggtggttatcatatgggaattact
gcggaaaacgttgctaaaaaatatgatatttcacgagaagagatggatgaatttagttat
caaagtcatcaaagagcagtgagtgcacaagataaacaccgctttgatgatgaaattgta
tcgttaccaatgattgatcgtaaaggtaattcttatgttgtcgatcaagatgaggcaccg
cgacgggatacatcattagaaaaattggccaaattgaagccagtttatcaagaagatggt
gcagttacggcggggaatgcttcaggcttaaatgatggtgcagctgcagtcgtattaatc
agtgaaagcaagatgcacgaattaggaatagaaccattagcacagtggcaagcgtctgca
ttagtagggctagagcctgaactaatgggaattggctcatactatgctgttgaaaagctt
tttaaagatcatcctgattttaaacaatctgaagttgattattttgaattaaatgaagct
tttgcggcaccatcattggtagttggtgatcaattattaggattagatccagcgattgtg
aaccctaatggtggtgcgattgcgttaggacatcctgttggtgcatccggaagtcgaatt
ttagttactttaatttatgaacttatccatgatgataagaaaactggagttgcggcactc
tgtgtaggtggtggaatgggtgtttcagcgttaattacacgataa

DBGET integrated database retrieval system