KEGG   Wenzhouxiangella marina: WM2015_1563Help
Entry
WM2015_1563       CDS       T04011                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
wma  Wenzhouxiangella marina
Pathway
wma00071  Fatty acid degradation
wma00072  Synthesis and degradation of ketone bodies
wma00280  Valine, leucine and isoleucine degradation
wma00310  Lysine degradation
wma00362  Benzoate degradation
wma00380  Tryptophan metabolism
wma00620  Pyruvate metabolism
wma00630  Glyoxylate and dicarboxylate metabolism
wma00640  Propanoate metabolism
wma00650  Butanoate metabolism
wma00900  Terpenoid backbone biosynthesis
wma01100  Metabolic pathways
wma01110  Biosynthesis of secondary metabolites
wma01120  Microbial metabolism in diverse environments
wma01130  Biosynthesis of antibiotics
wma01200  Carbon metabolism
wma01212  Fatty acid metabolism
wma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:wma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WM2015_1563
   00630 Glyoxylate and dicarboxylate metabolism
    WM2015_1563
   00640 Propanoate metabolism
    WM2015_1563
   00650 Butanoate metabolism
    WM2015_1563
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WM2015_1563
   00072 Synthesis and degradation of ketone bodies
    WM2015_1563
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WM2015_1563
   00310 Lysine degradation
    WM2015_1563
   00380 Tryptophan metabolism
    WM2015_1563
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WM2015_1563
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WM2015_1563
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WM2015_1563
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:wma04147]
    WM2015_1563
Enzymes [BR:wma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WM2015_1563
Exosome [BR:wma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WM2015_1563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKS41933
UniProt: A0A0K0XW79
Position
complement(1892566..1893849)
Genome map
AA seq 427 aa AA seqDB search
MTDTKLRKIAIVGGSRIPFCRSNSLYADQTNLDMLAAAIQGVTDRFELHGKQIDQVIGGA
VTTHSKDFNLAREAVLSTTLSPLTTGITLQQACGTSLTAALMAGAQIASGQIDCAIVAGT
DTTSDAPIVFQRKFAQRLIKLGRARSFGQKLGVFKGFSLRELAPQPPKNGEPRTGLSMGQ
HCERMAKEWSIDRREQDELTLDSHRKAAAAWDAGFFDDLVTPHNGVIRDSIIRPDTTLEK
LGSLKPVFDRKNGTLTAGNSTTLTDGAAAVLLASEEWAKANDLPILGWLTHGRTASVDFV
NKDEGLLMAPTVAVAEMLTRAGLSLQDFDFYEIHEAFAAQVLCTLRAWESERYCTERLGL
DKAMGSIDRAKMNVRGGSVAIGHPFAATGARILGTLGAILEEAGSGRGLISVCTAGGMGV
SAIVERD
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgactgatacgaaacttcgcaagatcgcgatcgtcggcggcagccgcattcccttctgc
cgttcgaacagcctgtacgcggaccagaccaacctggacatgctggccgcagccatccag
ggcgtgaccgaccgcttcgagctgcacggcaagcagatcgatcaggtcatcggcggcgcg
gtgaccacccattcgaaggacttcaacctggcccgcgaggcggtgctgtcgaccaccctc
tcaccgctgaccaccggcatcacgctgcagcaggcctgcggtaccagcctgaccgctgca
ctgatggccggcgcccagatcgcctcgggtcagatcgactgcgcgatcgtggcaggaacc
gacaccaccagcgatgcgccgatcgtcttccagcgcaagttcgcccagcgcctgatcaag
ctgggacgggcccgaagcttcggacagaagctgggcgtcttcaagggcttctccttgcgc
gagctggcgccacagcctccgaagaacggcgaaccccgtaccggcctgtcgatggggcag
cactgcgagcgcatggccaaggaatggtcgatcgatcgccgcgaacaggatgaactgacc
ctcgacagccaccgcaaggcggccgccgcctgggatgcaggcttcttcgacgatctggtc
accccccacaacggggtgattcgagacagcatcatccgtcctgacaccaccctggagaag
ctgggctcgctgaagccggtcttcgatcgcaagaacggcactctgaccgcgggcaattcc
accaccctcaccgatggtgccgccgccgtactgctggcgtccgaggagtgggcgaaggcc
aatgatctgccgattctcggctggctgacgcacggccgcacggcctcggtggatttcgtc
aacaaggacgagggtctgctgatggcgcccacggtggccgtggcggagatgctgactcga
gccggcttgagcctgcaggatttcgatttctatgaaatccacgaagcctttgccgcgcag
gtgctctgtacgctcagagcctgggaatcggagcgctactgcaccgaacggctcggcctg
gacaaggccatgggcagtatcgatcgggcgaagatgaacgtccggggtggttccgtggcg
atcggccatcccttcgcggccaccggggctcgcattctcggcaccctgggcgcgattctg
gaagaggccggttcgggccggggcctgatttcggtgtgcaccgccggcggcatgggcgtg
agcgcgatcgtcgaacgcgattga

DBGET integrated database retrieval system