KEGG   Wenzhouxiangella marina: WM2015_1769Help
Entry
WM2015_1769       CDS       T04011                                 

Definition
(GenBank) Putative pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
wma  Wenzhouxiangella marina
Pathway
wma00790  Folate biosynthesis
wma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    WM2015_1769
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:wma04147]
    WM2015_1769
Enzymes [BR:wma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     WM2015_1769
Exosome [BR:wma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WM2015_1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AKS42136
UniProt: A0A0K0XWY6
Position
2121499..2121840
Genome map
AA seq 113 aa AA seqDB search
MSDHSLSERKCLPCEGGTQPLGQDRIAELLPQIPGWQVDEEGKKIYRRYEFKGFYKTMAF
INAMAWIANQEAHHPDFEAGYNFCLVHFTTHAIDGLSENDFICAAKVNALLDD
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccactctctttccgaacgcaaatgcctgccctgcgagggcggcacccagccc
ctgggccaggaccgcatcgccgaactgctgccgcagattccgggctggcaggtggacgag
gaaggcaagaagatctatcgccgttacgaattcaagggcttctacaagaccatggccttc
atcaatgccatggcctggatcgccaatcaggaagctcaccatcccgatttcgaagccggc
tacaacttctgcctggtccatttcacgacccatgcgatcgatggattgagcgagaacgac
ttcatctgcgcggcgaaggtcaacgccctgctcgatgactga

DBGET integrated database retrieval system