KEGG   Wenzhouxiangella marina: WM2015_2284Help
Entry
WM2015_2284       CDS       T04011                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
wma  Wenzhouxiangella marina
Pathway
wma03010  Ribosome
Brite
KEGG Orthology (KO) [BR:wma00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    WM2015_2284
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:wma03011]
    WM2015_2284
Ribosome [BR:wma03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    WM2015_2284
  Bacteria
    WM2015_2284
  Archaea
    WM2015_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AKS42647
UniProt: A0A0K0XYD7
Position
complement(2705604..2705936)
Genome map
AA seq 110 aa AA seqDB search
MEATAKLKGARISAQKARLVADQIRGLPVDKADELLNFSSKKGAHIVRKVLLSAVANAEN
NVGADIDELKVSRIFVDEGPTLKRGRARAKGRYTRILKRTSHITVVVAED
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagctactgcaaaactgaagggtgcgcgcatttccgcgcagaaggcccgtcttgtg
gccgaccagattcgtggtctgccggtcgacaaggccgacgagctgctgaatttcagctcc
aagaagggcgctcacatcgttcgcaaggtgctgctgtccgcagtggccaatgcggagaac
aacgtgggcgcggatatcgatgagctgaaggtgtcccgcatcttcgtggacgagggtccg
acgctgaagcgtggccgggctcgcgccaagggacgctacacccgcattctcaagcggacc
agccacatcaccgttgtcgtggcagaggactaa

DBGET integrated database retrieval system