KEGG   Woeseia oceani: BA177_03595
Entry
BA177_03595       CDS       T04427                                 

Definition
(GenBank) hypothetical protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
woc  Woeseia oceani
Pathway
woc00230  Purine metabolism
woc01100  Metabolic pathways
woc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:woc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BA177_03595
Enzymes [BR:woc01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     BA177_03595
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C DOMON
Other DBs
NCBI-ProteinID: ANO50414
UniProt: A0A193LDF3
Position
complement(823555..825966)
AA seq 803 aa
MSDYKHIGKDFTPPDIKGKVTGKAKYAEDFRAEGMVYARLYTSPMAHGRVTNIDTSAAEN
MPGVIGILTADDVPVMEAPNAAILTNTPVYVGDPILAVAAEDETTAENALAAIKVTIEPL
PFAVDPLDSLIENGPDAREEGNVYVRSREGSGFRNIKWTPEQIAEFRAGKEPTGEHANEW
SYGDVDKGFAEASVIIEEPFVTTGYAHMSMEPRTAMAYWQNGTCYVYGSAQSQSFWMPGL
ARLLEVEMKDVVLVSEHTGGGFGSKIGAYPMAALPGWFSKKIGRPVQLRITREQEYYVGS
ARVGFQGWMKIGFAADGRMTAADMFIIEDIGPNATGGDGSSAAGAVSLVYDPLSMRFRGL
PVLTNTTPRGAQRGPGQNQIAAVMAPIMDKAAKQLNMDRVELRKVNAANNATTVYADQHS
ITSAYMKEALEMGAEMFDWAAKKYKPRKNGSKIRGLGVGQGYHSAGDKGYDGLVRITPDG
KIHLHSGVGNLGTYSYASTTRAAAEVLKCNWEDCVIHHGSTEANLPWSSYQAGSNTSFTH
QRANYVAAMDAVDKLKQVAAATLGGSADDYDIDGQRVFLASNAASGMSYAEAAAKAVQLG
GALSGETYPDDIHEITVRAVQNIAGTGLIGVAKDKLHQEGTIPGLAVAFAEIELDLETGK
YEILDYVGIAECGKVVHPQGLAAQMRGGAVWGMGMAGLERHVYDPQNGLPANVGYHQCRI
PSYLDTPSEIKTGAVDIPDPQSPFGARGIGEPAMGCSVAALTSAIADALDGHVFGRTPVS
PDMILNYVAGRDQSFKPLQTNNF
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgagcgactacaaacacataggcaaggacttcacgccgccagacatcaagggcaaagtc
accggcaaagccaagtacgccgaggacttccgcgcggaaggcatggtttacgcccggttg
tacaccagcccgatggcccacggccgggtcaccaacatagacaccagcgctgcggaaaac
atgcccggtgttatcggcatactgaccgccgacgacgtccccgtcatggaagcgccgaac
gcggccatcctgacgaacacgccggtgtacgttggcgacccgatcctggcggtggcggca
gaagatgaaaccacggctgagaatgcgttggcggccatcaaggtaaccatcgaaccgctg
ccgttcgcggtagacccgctcgacagcctgatcgagaacgggccggacgcccgcgaagaa
ggcaacgtctatgtgcgctcccgtgaaggctccgggtttcgcaatatcaaatggaccccg
gaacaaatcgccgaattccgcgccggtaaagaaccgaccggcgagcacgcgaacgaatgg
tcttacggcgatgtcgacaaaggttttgctgaagcgtcggtaatcatcgaagagccgttt
gtcacgaccggctatgcgcacatgagcatggaaccccgtaccgccatggcttactggcaa
aacggaacctgttatgtgtacggctccgcacaaagccagagcttctggatgcccggtctc
gcgcgcctgctcgaagtcgaaatgaaagatgtcgtactggtcagtgagcacaccggtggc
ggcttcggctccaagatcggcgcctacccgatggctgctctgcccggctggttctcgaag
aagatcggtcgaccggtgcagttgcgcatcacccgggaacaggaatattacgtaggctcg
gcgcgcgtgggcttccagggctggatgaaaattggttttgccgccgacggtcgcatgacc
gccgccgacatgttcattattgaagacatcggacccaatgcgactggcggcgacggttcg
tcggctgccggtgcggtatcgctcgtttacgacccgctgtccatgcgcttccgcggattg
ccggtactgaccaacactacgccacggggcgcgcaacgcgggcctggccaaaaccagatt
gccgccgtgatggcaccgatcatggacaaggctgccaagcagctcaacatggaccgcgtt
gagttgcgcaaggtcaatgccgcgaacaatgcaacaaccgtgtacgccgaccagcattcg
atcaccagcgcatacatgaaagaagcgctggaaatgggtgccgagatgttcgactgggcg
gccaagaaatacaagccgcgcaagaacggcagcaagattcgcggcctcggcgtcggccag
ggttatcactcggctggcgacaagggctacgacggcctggtgcggataacgccggatggc
aagattcatctgcacagtggcgttggcaatctgggtacgtacagctatgcctctacgacc
cgggccgccgcagaagtgctgaaatgcaactgggaagattgcgtcattcaccacggctcg
acggaagcgaacctgccgtggagcagctaccaggctggcagcaacaccagcttcacccat
caacgggccaattacgtggccgcaatggatgccgtcgataaactcaagcaagtcgccgcc
gccacactcggtggcagtgctgacgactacgacatcgatggccagcgcgtgtttctcgcc
agcaatgcggccagcggcatgagctacgcggaagcggcagcgaaagccgtccagctcggc
ggcgcgctcagtggcgaaacctatcccgatgacattcatgagatcacggtacgggccgtg
caaaacattgccggcaccggcctcatcggcgtcgccaaagacaagctgcaccaggaaggc
acgatacccggcctcgcggtcgcgttcgctgagattgaactcgacctcgaaaccggcaaa
tacgagattctcgattacgtcggcattgccgagtgcggcaaagtcgtgcatccgcaaggg
ctcgctgcacagatgcgcggcggtgctgtttggggcatgggaatggccggacttgaacgt
catgtctatgacccgcaaaacggcttgccggccaacgtcggctatcaccagtgccggatt
ccttcctacctggatacaccgtcagagataaagactggcgctgttgatattccggatcca
caaagcccgttcggcgcccgcggcattggcgagccggcaatgggctgctcagtggccgca
ctgacctcggcgattgcggatgcgctcgacggacatgtattcggtcgcacacccgttagt
cctgacatgattctgaactacgtagcgggacgtgatcagtcgttcaagccgttacagacc
aacaacttctga

DBGET integrated database retrieval system