KEGG   Woeseia oceani: BA177_05040Help
Entry
BA177_05040       CDS       T04427                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
woc  Woeseia oceani
Pathway
woc00790  Folate biosynthesis
woc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:woc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BA177_05040
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:woc04147]
    BA177_05040
Enzymes [BR:woc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BA177_05040
Exosome [BR:woc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BA177_05040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ANO53009
UniProt: A0A193LKS5
Position
1171554..1171838
Genome map
AA seq 94 aa AA seqDB search
MVEKLSDTDIHARLRDLPGWSLQDGKLTREFHFANFVDAFGFMTRAAMVAEKSNHHPEWF
NVYNKVKVQLTTHEAKGISERDFALAATMDELAP
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaaagcttagtgataccgatattcatgcgcgcttgcgcgacctgcctggctgg
tcattgcaggatggcaagttgacgcgtgagtttcacttcgcgaactttgtcgatgcgttc
ggctttatgacccgggccgcaatggtggccgaaaaatcgaaccatcacccggaatggttc
aatgtgtacaacaaggtcaaagtgcagctgaccacgcacgaggccaaagggatatccgag
cgcgattttgcgctggcagcaacaatggatgagcttgccccgtag

DBGET integrated database retrieval system