KEGG   Woeseia oceani: BA177_05610Help
Entry
BA177_05610       CDS       T04427                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
woc  Woeseia oceani
Brite
KEGG Orthology (KO) [BR:woc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BA177_05610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF1516
Motif
Other DBs
NCBI-ProteinID: ANO50751
UniProt: A0A193LE79
Position
1283333..1284583
Genome map
AA seq 416 aa AA seqDB search
MEAQLVYIALAAVFGIFMAWGIGANDVANAMATSVGSKALTIKQAILVAAIFEFLGAVLA
GGAVTSTIRKGIVDASLLNETPELLVYGMLASLLAAAIWLLIASRNGWPVSTTHSIVGAI
VGFAAVGIGMDAVQWGKVGTIVMSWVVSPVTAGFIAYLIFGSVQRLILTQPDPLEKARRY
VPVYIFFAAFTITLVTILKGLTHVGLELKMSHSYMLAVAIAIVVAAIGKVAIARIEPDPK
AEKKQHFHTVERVFAILMVVTACSMAFAHGSNDVANAIGPLAAVISIAQSGVIGAKSSIP
LWVLVLGGAGIVIGLATYGRHVIATVGEKITQLTPSRGFAAELAAATTIVIASGTGIPIS
TTHTLVGAVLGVGLARGIDAIDLRVVGRIFVSWAVTIPAGALLAILFFYILKAVLP
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaagcacaacttgtctatatcgcactcgcggcggtattcggcatattcatggcctgg
gggattggtgccaatgacgtcgccaatgcgatggcaacgtcggtcgggtcgaaagcactc
acaatcaagcaggcaattcttgtcgctgctatcttcgagtttctcggcgctgtactcgcc
ggtggtgcagttacatcgacaatacgcaaaggcatcgtcgatgcgagcttgctcaacgaa
acacccgagctgctggtttacggcatgctggcctcgttgctggccgccgcgatttggctg
ctgatagcatcacgtaacggctggccggtctccactactcattccatcgttggcgccatc
gtcggttttgccgccgttggcatcggtatggatgccgtgcagtggggcaaggttggcacc
atcgtgatgagctgggtggtatccccggttaccgccggttttatcgcttatcttattttt
ggcagcgtccaaagactcatcctgacccagccggacccactggaaaaagcgcgacgttat
gtgccggtctatatctttttcgcggccttcaccattacgttggtgaccatactcaaaggg
ctgacacacgtgggtctcgagctcaaaatgagccatagttatatgcttgccgtcgctata
gccatagttgttgcggccatcggcaaagtggcaattgcacggattgagccggaccccaag
gcggagaaaaagcagcacttccatactgttgaacgggtcttcgccattttgatggtcgtc
accgcctgttcgatggcgttcgcacacggttccaatgacgttgccaatgcgattgggccg
ttggcggcggtcatcagcattgcgcaaagtggcgtgatcggggcgaagtcgtcgataccg
ctttgggtactcgtgctgggtggcgcgggtattgttattggtcttgcgacgtacggccgc
cacgtgatcgcaacggtgggcgagaaaatcacccaactgacaccaagtcgcggttttgcg
gccgaactggcggcagcaacaaccattgttatcgcgtcaggtaccggtattcccatttcc
accacccacacactggttggtgcggtattgggtgtaggtctggcacgaggcatcgatgcg
atcgatctgcgagtggtcggacgcatcttcgtgtcatgggccgtgacaataccggcaggt
gcattgctggccatcctgttcttctacattcttaaagcggttcttccttaa

DBGET integrated database retrieval system