KEGG   Woeseia oceani: BA177_05865Help
Entry
BA177_05865       CDS       T04427                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
woc  Woeseia oceani
Pathway
woc00071  Fatty acid degradation
woc00072  Synthesis and degradation of ketone bodies
woc00280  Valine, leucine and isoleucine degradation
woc00310  Lysine degradation
woc00362  Benzoate degradation
woc00380  Tryptophan metabolism
woc00620  Pyruvate metabolism
woc00630  Glyoxylate and dicarboxylate metabolism
woc00640  Propanoate metabolism
woc00650  Butanoate metabolism
woc00900  Terpenoid backbone biosynthesis
woc01100  Metabolic pathways
woc01110  Biosynthesis of secondary metabolites
woc01120  Microbial metabolism in diverse environments
woc01130  Biosynthesis of antibiotics
woc01200  Carbon metabolism
woc01212  Fatty acid metabolism
woc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:woc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BA177_05865
   00630 Glyoxylate and dicarboxylate metabolism
    BA177_05865
   00640 Propanoate metabolism
    BA177_05865
   00650 Butanoate metabolism
    BA177_05865
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BA177_05865
   00072 Synthesis and degradation of ketone bodies
    BA177_05865
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BA177_05865
   00310 Lysine degradation
    BA177_05865
   00380 Tryptophan metabolism
    BA177_05865
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BA177_05865
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BA177_05865
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BA177_05865
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:woc04147]
    BA177_05865
Enzymes [BR:woc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BA177_05865
Exosome [BR:woc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BA177_05865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANO50794
UniProt: A0A193LEI4
Position
complement(1340787..1341965)
Genome map
AA seq 392 aa AA seqDB search
MKQDSIVIVAARRTPIGTFQGSLSAVKATDLSATATRAALADCGVDSASIDEVLMGCVLP
AGLGQAPARQAALAAGLPLGVPCTTVNKVCGSGMKTVMLGADLIRADSARVVLAGGMESM
SNAPYLMPKARSGYRMGHQEVLDHMFYDGLQSPFDGQMMGHFAEQTASKYGFTRKQQDAF
AVESVTRAANAANTGAFANEIAAVTVKSRKGETVVSSDEGPGAINVDKIPTLRPAFAADG
TVTAASSSSISDGAASLILMRDSDAEKAGIKPLVRIVGHSSYAQEPEWFTTSPVFAIKAL
HKKLGWSPESVDLYEINEAFACVTMAAMHDVGIPHEKVNVHGGACALGHPIGASGARLIV
TLIHALQKRGGGRGIASLCIGGGEAVAIGIEA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggactccatcgtaatcgttgcggctcgccgtacaccgatcggcacttttcag
ggctcactcagtgcggtcaaagccactgacctgtcggctactgccactcgcgcagcattg
gccgactgtggcgtggacagcgcatcaatcgacgaagtcctgatgggctgcgtactaccg
gctgggctcggccaggctcctgctcgtcaagcggcgcttgccgcgggtttgcccctcggc
gtaccgtgtacgaccgtcaataaagtctgtggctccggcatgaaaacggtgatgttgggt
gccgatctgattcgggctgacagcgcccgcgttgtcctggccggcggcatggaatccatg
agcaacgcgccgtatttgatgcccaaagcccgcagtggctaccgcatggggcatcaggaa
gtgctcgaccacatgttctacgacggcctgcaaagcccgtttgacggccagatgatgggg
cattttgccgagcagacggcgagtaagtacggctttacccgcaagcagcaagatgctttt
gccgtggaatccgttacccgtgcagccaatgcggcgaataccggagccttcgccaacgaa
attgccgccgttacagtcaagagccgcaaaggcgaaacggttgtcagcagcgacgagggc
cccggcgcaatcaacgtggacaagattcccacattgcgacctgcgttcgctgccgatgga
accgtcactgccgccagctcgtcctctatttctgacggtgccgccagcctgatactgatg
cgcgacagtgacgccgaaaaggccggcatcaaaccactggtccgtattgtcggacactcg
tcttacgcacaggaacccgagtggtttacgacctcaccggtcttcgccatcaaggcactc
cacaagaaactgggctggtcaccagaatcggttgatctttacgaaatcaatgaggccttt
gcctgcgttaccatggccgcgatgcatgacgtcggcatcccccatgaaaaggtcaacgtt
catggcggtgcatgcgcattaggtcatccaatcggcgcttcgggtgcacgactcatagtg
acgttgatacacgcattgcaaaagcgtggtggtgggcgcggtattgcgtcactgtgcatc
ggtggtggcgaggctgtagccatcggcattgaagcctga

DBGET integrated database retrieval system