KEGG   Woeseia oceani: BA177_08720Help
Entry
BA177_08720       CDS       T04427                                 

Definition
(GenBank) phosphatase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
woc  Woeseia oceani
Brite
KEGG Orthology (KO) [BR:woc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BA177_08720
Enzymes [BR:woc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     BA177_08720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: ANO51273
UniProt: A0A193LFM7
Position
complement(1964695..1965513)
Genome map
AA seq 272 aa AA seqDB search
MRFDLHTHTTASDGELSPAELLLRATDQGLTHIAITDHDTVAGYTDLEVPEGLSLIPGIE
FSSRWRKIGVHIVGLNIGLDHPTLTQAIAQQQQVRVERAQTIAERLMKLGIEDPLPAVTA
LAGGSNIGRPHFARHLVATGKVKNIREAFKKYLGAGKAGDVKQTWAPFDEVVGWINNAGG
IAVLAHPAHYRLTQSKLQELVADFADADGASIEVVSGSQEPTVTRKLSSLCNDFDLHASV
GSDFHRADARWAELGRFAALPDTCQPVWDLWQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcgacctgcatactcacacgactgcatcggacggtgaactgtcgcccgccgaa
ctgctgttacgcgccactgaccaggggcttacccacattgcgatcacggatcacgatacg
gtggccggctatactgacctcgaagttccggaagggctttcgcttataccggggatcgaa
ttttccagccgttggcgaaagatcggtgtgcatatcgtcgggctgaacatcggactggac
caccccaccctcactcaggcgattgcacagcagcaacaggtgcgagttgagcgtgcacaa
accattgccgaacgactgatgaagttgggcatcgaagacccgcttcccgctgtcactgcc
cttgccggcggcagcaacatcggtcgcccgcatttcgcccgtcacctcgttgccacgggc
aaagtcaagaacattcgcgaagcgttcaaaaagtacctcggggccggcaaggccggagac
gttaagcagacctgggcgccctttgacgaagtggtgggctggatcaacaatgccggcggt
atcgccgtccttgcccaccccgcgcattaccgcctgactcaaagcaagttgcaggagctc
gttgccgacttcgcagacgcagacggggcctccatcgaagtcgtgtcgggaagccaggaa
cccaccgtaacccgaaaattatccagcctctgcaacgactttgacctgcacgcctccgtc
ggttccgattttcatcgagcggacgcccgttgggcggaattgggtcggttcgcggccttg
cccgacacctgccaaccggtctgggatctgtggcaatga

DBGET integrated database retrieval system