KEGG   Wolbachia wMel (Drosophila melanogaster): WD_0095Help
Entry
WD_0095           CDS       T00160                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
wol  Wolbachia wMel (Drosophila melanogaster)
Pathway
wol00550  Peptidoglycan biosynthesis
wol01100  Metabolic pathways
wol01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:wol00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    WD_0095
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WD_0095
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    WD_0095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:wol01011]
    WD_0095
Enzymes [BR:wol01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     WD_0095
Peptidoglycan biosynthesis and degradation proteins [BR:wol01011]
 Precursor biosynthesis
  Amino acid ligase
   WD_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 Toxin_R_bind_C ATPgrasp_TupA
Motif
Other DBs
NCBI-ProteinID: AAS13853
UniProt: Q73IQ8
Position
87366..88313
Genome map
AA seq 315 aa AA seqDB search
MIPTIAILSGGFSCEREISLMSGKAVKKALDSLSYNAIEIDVDSNIAEKLKKINPGLAFI
ALHGPYGEDGCIQGLLEILGIKYTHSGVMASAVAINKVMSKHIFRSLNIDTPKGYVISRE
DVLKNNIKIDYPYVLKPINEGSSIGVYIIFSHEDYLELKNNSSTIMEKMIVEEYIPGIEL
HTAVLLDEAIGTIEVRPKNKFYDYEAKYTDGFAEHIFPAKIPDNIYKMTLEHALKIHQFL
GCKTISRSDFRYNPKNNTLKMLEINTHPGFTELSLVPEIAKLAKGINFNELVKIIIEDSL
QHKNIRDLSHVEQYY
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgattccaactatagcaattttaagtggtggattttcttgtgagagagaaatatcgctt
atgagcggaaaagcagtgaagaaggcgctcgatagcctttcatataatgcaatagaaata
gatgttgacagcaatattgctgaaaagcttaaaaaaattaatccgggccttgcttttatc
gctctgcatggaccttatggtgaagatggctgcattcaaggtttattggaaatcttaggt
ataaaatatacacactcaggagttatggcttctgccgttgctataaataaagtgatgtca
aagcatatatttcgatcccttaatatcgacactccaaaaggttatgtaattagccgagaa
gatgtactaaaaaataatattaaaatcgattatccgtacgtcttaaaaccaattaatgaa
ggttcaagtattggagtgtacataattttctcgcacgaggattacttagaactgaaaaat
aatagttctactataatggaaaagatgatcgtagaagaatacataccgggcatagagtta
catactgctgtattgctggatgaagcaattggcactatagaagtacgaccaaaaaataaa
ttctatgattatgaagcaaagtatacagatggatttgcagaacatatatttcctgctaaa
attcctgacaatatatataaaatgaccttggaacacgcactgaaaatacatcaattttta
ggatgcaaaactatttcccgctcagatttccgttataatcccaaaaataacactttaaaa
atgcttgagattaatacacatcctggctttactgagttatcgttagtgccagaaattgca
aaattggcaaaaggaatcaattttaatgaattagttaaaattattattgaagatagtttg
cagcacaaaaatattagggatttaagtcatgttgagcagtattactag

DBGET integrated database retrieval system