KEGG   Wolbachia wMel (Drosophila melanogaster): WD_0139Help
Entry
WD_0139           CDS       T00160                                 

Definition
(GenBank) transcriptional activator, tenA family, putative
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
wol  Wolbachia wMel (Drosophila melanogaster)
Pathway
wol00730  Thiamine metabolism
wol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wol00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    WD_0139
Enzymes [BR:wol01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     WD_0139
Transcription factors [BR:wol03000]
 Prokaryotic type
  Other transcription factors
   Others
    WD_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AAS13893
UniProt: Q73IL8
Position
127119..127790
Genome map
AA seq 223 aa AA seqDB search
MNLLVSGQPLKEFSDLIDKIKEHPFNVELINNTLDYEKFKFYLQQDFLYCIDCARAFLIV
AARVDDIEMMSSLINLAQGAFYVREQCKKYFEDCDLSDDHKKSRACSAFTDFFMSAAYHN
SVNEALVASYSCFNIYQIVIRHMVNEITTKGVKNNKYKEWINIYSSETVNAVIDEVTDIT
NKLYKKASDCEKKRMYEFFKKGLELEIMFWDEAYYSNISSKEY
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
ttgaatttactagtttccggacaacctctaaaagagttttctgatcttattgataaaata
aaagaacacccttttaatgttgaattgataaataatacattagattatgaaaaattcaaa
ttctaccttcagcaggattttctgtattgtatagattgcgctcgtgcttttttaattgtt
gcagctagagttgatgatattgaaatgatgagtagtttaatcaatttggcacaaggagca
ttttatgttcgagaacagtgtaaaaaatattttgaagattgtgatctatctgatgatcac
aaaaagtcaagagcttgttctgcctttactgactttttcatgagtgccgcatatcacaat
tctgttaatgaagctttagtagcatcttattcttgctttaacatataccaaatcgttata
cgccatatggtaaatgagataacaactaaaggggttaaaaataacaaatacaaagagtgg
atcaacatttatagtagcgaaacagtaaatgctgtaattgatgaggttactgatattaca
aataagctatataaaaaagctagtgactgtgaaaaaaagaggatgtatgagttttttaag
aaagggctggaattagaaataatgttttgggatgaggcatattactctaatatatctagc
aaagaatattag

DBGET integrated database retrieval system