KEGG   Wolbachia wMel (Drosophila melanogaster): WD_0618Help
Entry
WD_0618           CDS       T00160                                 

Definition
(GenBank) L-allo-threonine aldolase, putative
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
wol  Wolbachia wMel (Drosophila melanogaster)
Pathway
wol00260  Glycine, serine and threonine metabolism
wol01100  Metabolic pathways
wol01110  Biosynthesis of secondary metabolites
wol01120  Microbial metabolism in diverse environments
wol01130  Biosynthesis of antibiotics
wol01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:wol00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WD_0618
Enzymes [BR:wol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     WD_0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 betaPIX_CC
Motif
Other DBs
NCBI-ProteinID: AAS14319
UniProt: Q73HE6
Position
602278..603330
Genome map
AA seq 350 aa AA seqDB search
MRVKIDFFSDSNTDPSAKMREAMAKAKVGNEAACEDPTVNELVATACKILGKPAGIFLIS
GTMSNVIAYKVHIQRPGDYLLLDETSHPLIVQSGLIAAQAHATPLPIKGTRGIFTGEQIV
EFITRPSLRNIPRVGLVSIEQTTNFGGGAVWPLEYIQEISSLCKENDVFTHLDGARLFNA
CAHTKISPKEYASYFDSVFIDFSKGLGAPMGAILLGSEDFIEKAWYYKFQIGGGMHQAGI
ISAACLYALRNNVNSLEEDHKKMQHLIEGLDSIDQVIIDIDLYKTNIAYFSLRTNCISTQ
ELINVLMTNYGIRMANIKGKIRAITHRDISYEDINTTVSAIRKILSNFLH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaaaatagatttctttagcgattcaaacactgacccttcagctaaaatgagg
gaagcgatggctaaagcaaaagttggaaacgaagctgcatgtgaagatccaactgtgaac
gaattagtggcaaccgcatgtaaaatattaggtaaacctgcaggaatctttttgatttca
ggaacgatgtccaatgtaattgcttataaagtacacattcaaagacctggtgattacttg
ctgcttgatgaaacttcacatccactcatagtacaatctggcttgatcgcagcccaggca
catgctactcctttgcccatcaaaggtacaagaggaatatttactggagaacaaattgtt
gagtttattactcgtcctagtttaagaaatattccgagagttgggcttgtttctatcgaa
caaacgacaaattttggtggtggagctgtgtggcctttagaatatattcaagagatctca
agtctctgcaaagagaatgacgtattcactcatttagatggagcaagactgttcaacgct
tgtgctcatactaaaatatctccaaaggagtatgcaagttattttgattcggtattcatt
gattttagtaaaggattaggtgctccaatgggtgcaatattgcttggaagtgaagatttt
attgaaaaagcttggtactataagtttcaaattggcggaggtatgcaccaagctggcatt
atttcagctgcatgtttatatgctctacgtaataatgtaaattctttagaagaagatcat
aaaaaaatgcagcaccttatagaaggcctagactccatagatcaagttataattgatatc
gacctgtataaaactaatatagcgtatttttcattacgtactaattgtatatctactcaa
gaattaataaacgtactaatgacaaattatggaattagaatggctaacatcaaaggtaaa
atcagagctataacacatagagatataagctatgaagatattaatactactgtatctgct
ataagaaagatactaagtaattttctgcactaa

DBGET integrated database retrieval system