KEGG   Wolbachia wOo (Onchocerca ochengi): wOo_05000Help
Entry
wOo_05000         CDS       T02212                                 

Definition
(GenBank) Asp-tRNAAsnGlu-tRNAGln amidotransferase A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
woo00970  Aminoacyl-tRNA biosynthesis
woo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:woo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    wOo_05000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:woo03029]
    wOo_05000
Enzymes [BR:woo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     wOo_05000
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     wOo_05000
Mitochondrial biogenesis [BR:woo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    wOo_05000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase SWIRM-assoc_3 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: CCF78166
UniProt: I7ITR3
Position
complement(431546..433021)
Genome map
AA seq 491 aa AA seqDB search
MNELRKLSITEMRDGLNRKDFSAVELTEVHINAVEDEKLNAFVTKTPEIAIKAAKAADEH
FSKQKDDITPPLMGIPVGVKDLFCTKGIKTTACSKMLENFVPTYESTVSKLLLKSGAAML
GKLNMDEFAMGSANTNSWFGPVENVWTRKSDGEKVVPGGSSGGSASAVAGFLCAGALGSD
TGGSVRQPAAYCGVVGIKPTYGRCSRFGMIAFASSLDQAGVITRSVSDSALMLETICGYD
NKDSTSSERLVPKFSSLISGDIKGKSIGIPKEYRMDGISEEIVHYWEKVSSNLKESGAKI
VDIALPYTKYAIPVYYLICSAEASSNLARYDGVHYGFRADADTLEEMYSLTRAEGFGKEV
KRRILIGAYALSSGHYNEYYEKAQCIRALIRNDFIKAFEKVDYILVPSAPTEAFGLNEKP
DPIIMCINDVFTVPASLAGLPAISIPVGLSSEGLPLALQVIGNYYDEAGILNVANVIEQN
CGRIIELRSLV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaactaagaaagttaagcattacagagatgcgtgatgggctcaatcgaaaagat
ttttccgctgttgaacttacagaggtacatatcaatgcagttgaagatgagaaactaaat
gcatttgtaacaaaaactccagaaatagcaataaaagccgctaaagcagcagatgaacat
ttttcaaaacagaaagacgatataactccaccgctcatgggcataccagttggggtcaaa
gatttattctgcacaaaaggaataaaaacaacagcatgttcaaaaatgctagaaaacttc
gttcctacttacgaatctacagtatctaaattgcttctaaaaagcggagcagccatgctt
ggtaagcttaacatggatgaatttgctatgggctccgcaaacacaaacagctggtttggt
cctgttgaaaatgtttggactaggaaaagtgatggggaaaaggttgtacctggtggatca
tctggcggatctgcatcagcagttgccggattcttatgcgctggagcactcggaagtgac
accggtggatctgtacgccaaccagcagcttattgtggagtagttggaataaaaccaacc
tatgggaggtgttcacgttttggcatgatcgcatttgcaagttctttggatcaagcagga
gttataacccgttctgtctctgactcagcattaatgctggaaacaatttgtggctatgat
aataaagactcaacatcaagcgaaaggctagtacctaagttttctagccttataagtggt
gatattaagggcaaaagcattggtataccaaaagagtatagaatggatggaatttcagaa
gaaatcgtccactattgggaaaaagtttcttccaatttaaaagaaagcggtgctaaaatt
gttgatattgccttgccatacactaaatatgcaataccagtctactatttaatctgctct
gctgaagcttcatctaatcttgctcgctacgatggtgtgcattacggattcagagctgat
gctgatacccttgaagaaatgtactcactaacaagagcagaaggttttggaaaagaagtg
aaaagaagaatcctcatcggtgcttatgcactttcttcaggtcattataatgaatattat
gaaaaagcacaatgtattagagcattaatcaggaatgattttataaaagcattcgagaaa
gtagattacatacttgttccatccgctccgacagaagcttttggcttaaatgaaaagcca
gacccgataattatgtgcatcaatgatgtttttactgtaccagcaagtttagctggccta
cctgctatttctattcctgttggactttctagtgaagggctaccacttgctttacaagta
attggaaactattatgatgaagctggaatattgaatgtagcaaatgtaatcgagcaaaat
tgtggtaggataattgaactacgtagcttagtttga

DBGET integrated database retrieval system