KEGG   Weissella paramesenteroides: CO680_01180Help
Entry
CO680_01180       CDS       T05120                                 

Definition
(GenBank) TIGR01457 family HAD-type hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
wpa  Weissella paramesenteroides
Pathway
wpa00627  Aminobenzoate degradation
wpa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:wpa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CO680_01180
Enzymes [BR:wpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     CO680_01180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2
Motif
Other DBs
NCBI-ProteinID: ATF40751
UniProt: A0A4Q7ISV6
Position
230410..231189
Genome map
AA seq 259 aa AA seqDB search
MVTHYDGYLIDLDGTIYQGTKQFPSGRRFINRLAASQTKYLFVTNNSTKTPEAVAENLTN
NHQIPTTPDQVYTSAMALADYLEKFDQIHRVLMIGEEGLEQALLAKGFELVTEAPADAVA
IGLDRAVTYEKILQGTLAIQQGAMFVATNPDTNLPTERGMVPGAGSVVAFLATAVRPAPI
VIGKPEHIIMDGALDKLQIKRHEAIMVGDNYNTDIKAGLSADIDTLLVYSGVSKKDDVLK
QAKQPTHWVDSLDDWTIEK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtaacacactacgatggatatttaattgatctagatggtacgatttatcaaggaacg
aaacaatttcctagtggccgtcgtttcattaatcgtttagcggctagtcaaacaaaatat
ttgtttgtgaccaataattcgacgaaaacacctgaggcggttgctgaaaatttaaccaat
aatcaccaaattccaacaacgccagatcaggtttatacatctgccatggcattggctgat
tacttagaaaaatttgatcaaattcatcgtgtattgatgattggagaagaaggattagaa
caagccttattagccaagggctttgagctagtaactgaagcacctgctgatgcagttgca
attggcttagatcgagcggttacttacgaaaaaattctgcaaggtacattggctatccaa
caaggtgccatgtttgttgcaactaatccagacaccaatttgccaacggaacgggggatg
gtgcccggtgctggttcagtggttgcctttttggcgacagcagtcagacctgcaccaatc
gtgattggtaagccggagcatatcattatggatggtgcgctagataaattacaaattaaa
cgtcatgaagcaattatggttggtgataactataatacagatattaaggcagggttgagt
gcggacattgatacattactagtttattcgggtgtttcgaaaaaagatgatgtattaaaa
caagctaaacaaccaacacattgggttgattcattagatgattggaccattgaaaaataa

DBGET integrated database retrieval system