KEGG   Weissella paramesenteroides: CO680_01420Help
Entry
CO680_01420       CDS       T05120                                 

Definition
(GenBank) polyprenyl synthetase family protein
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
wpa  Weissella paramesenteroides
Pathway
wpa00900  Terpenoid backbone biosynthesis
wpa01100  Metabolic pathways
wpa01110  Biosynthesis of secondary metabolites
wpa01130  Biosynthesis of antibiotics
Module
wpa_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:wpa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CO680_01420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:wpa01006]
    CO680_01420
Enzymes [BR:wpa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     CO680_01420
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     CO680_01420
    2.5.1.29  geranylgeranyl diphosphate synthase
     CO680_01420
Prenyltransferases [BR:wpa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CO680_01420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ATF40796
UniProt: A0A4Q7ITZ4
Position
280824..281696
Genome map
AA seq 290 aa AA seqDB search
MQFKEFSTNIVPQIEHTLENELAKSASVAELQEAMRYAVMAGGKRLRPMLSLAVIQTYGL
PVNEYLKVASAIELIHTYSLIHDDLPAMDDDELRRGKPTTHRAFGEDTAILAGDALQPLA
FEWLTDLDQPLNDAQRVQLVIAMAQAAGGAGMVAGQVLDIEAMKTSAVTLAETQAIHYHK
TGALIAYALQAGAIMANANEDIQNILHDFGMAYGLAFQIKDDIDDYQPGKIESQAYPTIL
GLSETVVALQKQVDLAQSLLLKFEDITGLDKTLLASFLDYFTETLEQTWE
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttaaagaattctcgacaaatattgtccctcaaattgaacatactttagaaaat
gaacttgctaagagtgcctcggtagcagaattacaagaagcgatgcgctatgcggtaatg
gctggtggtaaacggcttcgtccaatgctgtcattggctgttattcaaacttacgggcta
ccagttaatgaatatcttaaagtagccagtgcaatcgagcttattcatacctatagttta
attcatgacgatttaccagcaatggatgatgatgaattgcgacgtggcaagccgacaacg
catcgggcatttggtgaggatactgctattttagctggggatgccctacagccattggct
tttgaatggttaacggatttagatcaacctttgaatgatgcccagcgagtacagctagtt
attgcaatggcgcaagctgctggtggagctggtatggttgctggacaggtactagatatt
gaggcgatgaaaacgtccgcagtgacattagctgaaacacaggccattcattatcataaa
acaggtgcattaattgcatacgcactacaagcaggtgccattatggctaatgcaaatgaa
gatattcaaaatatattgcatgattttgggatggcctatggattggcttttcaaataaaa
gacgatattgatgattatcaacctggcaagattgaatcacaagcttatccaacaattctt
gggttatcagaaacagtggtggcattacagaagcaagtcgatcttgcccaaagtctgctt
ttaaagtttgaagatatcacaggcttggataagacattattagcatcatttttggattat
tttacagaaacattggagcaaacatgggaatag

DBGET integrated database retrieval system