KEGG   Weissella paramesenteroides: CO680_07085Help
Entry
CO680_07085       CDS       T05120                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
wpa  Weissella paramesenteroides
Pathway
wpa00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:wpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CO680_07085
Enzymes [BR:wpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CO680_07085
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CO680_07085
    1.1.1.-  
     CO680_07085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 ADH_N_assoc Glu_dehyd_C 2-Hacid_dh_C PALP UDPG_MGDP_dh_N Gp_dh_N 3HCDH_N Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ATF41822
Position
complement(1429141..1430193)
Genome map
AA seq 350 aa AA seqDB search
MKAAVWHGVKDIRVEDVDLKPAKDNEVVIRVAYAGICGSDLHEYLEGPVFIPVDKVDELT
GGEAPLTMGHEFSGVIESVGKDVKNYKVGDHVSVNPTVTHGESPDDVDVYDGYSFIGLSC
DGGFAAHVNVPEGNLYALPEEFPLKLAATIEPTAVAVQAVKEGGLKFGQKVAIFGAGPIG
VLVAAAAKAAGATKIVAIDLSAVRLEKALTMGATDVVNPGEVDDAVAAVREILGGGADVS
FEVAGVQPTFEQAIDVTKARGTAVIVSIFAHPISFDPMQLMNAGVKLTSTIAYSRETFQQ
TVDLVSSGQINVEPVITDIIGLDDVVEKGFDRLSTDKSQAKILIDLTKED
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcagtatggcatggcgtaaaggatattcgtgttgaagatgtagacttgaag
ccagcaaaggacaatgaagtcgttattcgtgtggcatatgcaggaatctgtggcagtgac
ttgcatgaatacttagaaggaccagtttttattccagttgataaagttgacgaattgact
ggtggcgaagcaccactaacaatgggacatgaattctcaggtgtcattgaatcagttggt
aaggatgttaagaactacaaagttggagatcatgtatctgttaacccaactgtgacacat
ggtgaatcaccagatgatgtggatgtttatgatggctacagtttcattggtctaagttgc
gatggtggttttgctgcccatgttaatgtaccagaaggtaatctatatgcattgccagaa
gaattcccactaaagttggctgcaacgattgagccaacagccgtcgctgtacaagcggtt
aaagaaggtggcttgaagtttggtcaaaaggttgccatcttcggtgccggaccaatcggt
gtgctagttgccgcagctgcaaaggctgctggtgctactaagattgttgctattgatcta
tcagccgttcggttggaaaaggcattgactatgggagcaactgatgttgtgaaccctggt
gaagttgatgatgcagttgctgctgtccgcgaaattttgggtggtggtgcagatgtatca
tttgaagttgccggtgtacaacctacttttgagcaagcaatcgatgtaacgaaagctcgt
ggaacggcagtgatcgtttcaatctttgctcacccaatctcatttgacccaatgcaatta
atgaatgctggtgttaagttgacatcaacgattgcatactcacgtgagaccttccaacaa
acagttgatcttgttagctcaggtcaaatcaatgttgagccagttattacggatattatt
ggtttggatgatgtcgttgaaaagggatttgatcgcctatcaacagacaagtcacaagct
aagatcttgattgacctaactaaggaagattaa

DBGET integrated database retrieval system