KEGG   Wolbachia wPip (Culex quinquefasciatus): WP0533Help
Entry
WP0533            CDS       T00719                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
wpi  Wolbachia wPip (Culex quinquefasciatus)
Pathway
wpi00471  D-Glutamine and D-glutamate metabolism
wpi00550  Peptidoglycan biosynthesis
wpi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wpi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    WP0533 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WP0533 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:wpi01011]
    WP0533 (murD)
Enzymes [BR:wpi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     WP0533 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:wpi01011]
 Precursor biosynthesis
  Amino acid ligase
   WP0533 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C MeaB TrkA_N ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: CAQ54641
UniProt: B3CPY8
Position
573149..574504
Genome map
AA seq 451 aa AA seqDB search
MVRISYLEVQLNKYKNQSVAVFGLGKTGLSVINALTKSSAKIYAWDDNKEQIANAKKIYK
ECNFTHPNEYNWHEISTLILSPGVPIPTHWVVKLARSFDCKIKSDIELFLETKTTNQKVI
GITGTNGKSTTTSLIGHILKSTGKKVAIGGNLGMPILDLERDAEIYVIEFSSFQLELMNE
INVDISVLLNITPDHIDRHGSMNNYIATKLKLINGSKIAVIGCDNKITSDVFNKFTGNKI
PISASMSPSLSSQCLGTGKLENHSLSVSDVKINLVSNVENIVAAHAVCKLLGVDSSTIVN
EIKSFPGLRHRNEFLGKIHNVLFINDSKATNAESTEKAILSYKNIYWIVGGKSKKGGIES
LSKHFTKIRKAFLIGESTEVFANIMENKIDYMKCYNLENAFKLAFEEAINSKEEVAILLS
PACSSFDQWKNFEERGEAFCRMFANLRYNYM
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggttcgcataagttatctagaagtgcaactaaacaaatacaaaaatcaaagtgttgcg
gttttcggccttggtaaaactggtttgtccgttattaatgctctaacaaaaagcagtgca
aaaatatatgcatgggatgataataaagagcaaatagcaaatgcaaaaaagatatataaa
gagtgtaactttactcatcccaatgagtataattggcatgagataagcacactaattttg
agccctggagtgccaataccaacgcattgggtagtaaaacttgcaagaagctttgactgc
aaaataaaatcagacattgagctatttcttgaaactaaaactacaaatcagaaggttata
ggcattacaggaacaaatggcaaatcaactaccacatcactaatagggcacatattaaaa
tccacagggaaaaaagtagctatcggtgggaatttaggtatgcctattttggatttagaa
agagatgcagaaatttatgtaattgaattctcctcttttcaattggagctaatgaatgaa
attaatgtggatatttctgtattgcttaacatcacaccagaccacatagatagacatgga
agtatgaataactatatagcaactaaactaaaattgataaacggtagcaagattgccgtg
ataggatgtgataacaaaattacctctgatgtattcaataaattcactgggaacaaaatt
ccaatctcagcttcgatgtcaccctctttgtcatcccagtgcctaggcactgggaaacta
gagaatcatagcttatcagtaagcgacgtgaaaataaacctagtatccaatgtagaaaat
atagtagctgcacacgctgtgtgcaagttacttggagtagatagcagcactattgtcaat
gaaatcaaatcctttccagggctaagacacagaaatgaatttcttggcaaaatacataat
gtactttttatcaacgatagcaaagcaaccaatgcagaatcgaccgaaaaggcaatttta
tcttataaaaacatatattggattgttggcggaaaaagcaaaaaaggcggaatagaatca
ttaagcaagcatttcaccaagattagaaaagcttttcttattggagaatcaactgaagtt
tttgcaaacattatggagaacaaaatagattatatgaagtgctataatctagaaaacgca
tttaaactggcttttgaagaggccataaatagcaaagaagaagtagcgatattactttct
cctgcatgttcttcttttgatcagtggaaaaattttgaagagcgcggtgaagcattttgc
agaatgtttgcaaatctcaggtacaattatatgtga

DBGET integrated database retrieval system