KEGG   Wolbachia wPip (Culex quinquefasciatus): WP0718Help
Entry
WP0718            CDS       T00719                                 

Definition
(GenBank) apaG protein
  KO
K06195  ApaG protein
Organism
wpi  Wolbachia wPip (Culex quinquefasciatus)
Brite
KEGG Orthology (KO) [BR:wpi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    WP0718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: CAQ54826
UniProt: B3CLQ8
Position
complement(783720..784124)
Genome map
AA seq 134 aa AA seqDB search
MTMKYTLITNSVEVTVLPIYIEEQSIPYENCYVWMYNVKIKNKSSSTIQLLSRYWQIIDH
KGKINEIAGVGVIGEQPVIKSGEVFKYTSGTYLNTPSGIMQGKYEFLNEESIKTFDVMVP
PFSLDSPYVNTRPH
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaaatacacacttattactaattctgttgaagttacagttttgccaatttac
attgaagagcaatccattccttatgaaaattgttacgtatggatgtataatgttaagata
aaaaacaaaagctcatcaaccattcaattattaagtcgctattggcaaataatagatcat
aaggggaaaataaatgaaattgccggagttggtgttattggagaacaacctgtaataaaa
tctggagaggtattcaaatatacaagtggaacatacttaaatacaccatcaggaataatg
cagggtaaatatgaatttctgaacgaagagagcataaaaacctttgatgttatggtacca
cccttttccttagatagtccatacgttaacactagacctcattga

DBGET integrated database retrieval system