KEGG   Wolbachia wRi (Drosophila simulans): WRi_002430Help
Entry
WRi_002430        CDS       T00866                                 

Gene name
gatA
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
wri  Wolbachia wRi (Drosophila simulans)
Pathway
wri00970  Aminoacyl-tRNA biosynthesis
wri01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wri00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    WRi_002430 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:wri03029]
    WRi_002430 (gatA)
Enzymes [BR:wri01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     WRi_002430 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     WRi_002430 (gatA)
Mitochondrial biogenesis [BR:wri03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    WRi_002430 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase SWIRM-assoc_3
Motif
Other DBs
NCBI-ProteinID: ACN95068
UniProt: C0R5M6
Position
complement(251411..252880)
Genome map
AA seq 489 aa AA seqDB search
MNELRKLSITQMHDGLKKKSFSAVELVEAHISAVENEKLNAFITKTPEIAMKAAKAADEH
FSRQKDDLISPLMGVPVGIKDLFCTKGIKTTACSKMLENFVPTYESTVSDLLLKSGAAML
GKLNMDEFAMGSANTNSYFGPVENVWIRKSDGEKVVPGGSSGGSAASVAGFLCAGALGSD
TGGSVRQPAAYCGVVGIKPTYGRCSRFGMIAFASSLDQAGVITRSVSDSALMLEAICGYD
TKDSISSEKPVPKLSSFINGDVKGKCIGIPKEYRMDGISEEIVHNWERVASYLKENGAEV
VDITLPHTKYAIPVYYLICSAETSSNLARYDGVRYGLRVDADTLEEMYSLTRAEGFGKEV
KRRILIGAYALSSGHYNEYYEKAQCIRALIRNDFIKAFEKIDYILVPSAPTEAFGLNEKP
DPLIMCINDVFTVPASLAGLPAISVPVGLSNEGLPLALQVIGNYYDEAGILNVASVIEQN
CGRIIRPLA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaactaagaaagttaagtattacacaaatgcatgacgggctcaaaaaaaagagt
ttttctgccgttgaactcgtagaggcgcacatcagtgcggttgaaaatgagaaattaaat
gcatttataacaaaaaccccagagatagcaatgaaagctgctaaagctgcagatgaacat
ttctctaggcaaaaggatgatttaatctcgccgctcatgggtgtaccagttggcatcaaa
gatctattctgtacaaaaggaataaaaacaacagcatgctcaaaaatgctggaaaatttc
gttccgacttacgaatctacggtgtctgacttgcttttaaaaagtggagcagccatgctc
ggtaagcttaatatggatgaatttgctatgggttctgcgaacacaaatagctattttggc
cctgttgaaaatgtgtggattagaaaaagcgatggggaaaaagttgttcctggtggatca
tctggtggatctgcagcatcggttgctggatttttatgcgctggagcgttagggagcgac
accggtggatctgtacgccaaccagcagcttattgtggagtggttggaataaagccaact
tatggaagatgctcgcgttttggtatgattgcatttgcgagttctctggatcaagcagga
gtcattactcgttctgtctctgattcagcattaatgctggaagcaatttgtggctatgat
acaaaagattcaatatcgagcgaaaagccagtgcctaaactttctagctttataaatggt
gatgtcaagggtaagtgtattggtataccaaaagaatataggatggatggaatttcagag
gaaatagttcataattgggaaagagttgcttcctatttaaaagaaaatggcgctgaagtt
gttgacattactctgccacatactaaatatgcaataccagtctattatttaatctgttct
gctgaaacttcatccaatcttgctcgttacgatggtgtgcgttatggattaagggttgat
gctgatacccttgaagaaatgtattcactaacaagagcagaaggtttcggtaaagaggtg
aaaagaagaattttaattggcgcttatgcgctttcctcaggtcattacaatgaatattac
gaaaaagcacagtgtatcagggcattaatcagaaatgattttataaaagcgtttgaaaaa
atagattacatacttgtgccatctgctccaacagaagcttttggcttaaatgaaaagcca
gatccgctaattatgtgcatcaatgatgtgtttactgtgccggcaagtctggcaggattg
cctgctatttctgttcctgttgggctctccaatgagggtttaccacttgccttgcaagtg
attggaaattattatgatgaagctggaatattaaatgtggcaagtgtgatagagcaaaat
tgcggcagaataattagacctcttgcataa

DBGET integrated database retrieval system