KEGG   Wolbachia wRi (Drosophila simulans): WRi_003570Help
Entry
WRi_003570        CDS       T00866                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
wri  Wolbachia wRi (Drosophila simulans)
Pathway
wri00020  Citrate cycle (TCA cycle)
wri00310  Lysine degradation
wri01100  Metabolic pathways
wri01110  Biosynthesis of secondary metabolites
wri01120  Microbial metabolism in diverse environments
wri01130  Biosynthesis of antibiotics
wri01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:wri00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WRi_003570 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    WRi_003570 (sucB)
Enzymes [BR:wri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     WRi_003570 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACN95166
UniProt: C0R2M4
Position
381869..383041
Genome map
AA seq 390 aa AA seqDB search
MSKIIEIRAPKTLGGESVTEGIVKIKKGIGEAVKVDDLIFEIETDKTALELTAEASGQIT
EFLVKEDDVISPDQLLAKLSVGEVKEEAKKEDKSESAAKKDAPSARKIMEENAISAESVK
GTGMGGRITKADVIGHMNKAEQPAIKQYELPKSVVNGEQREERVKMSKIRQVIAARLKAS
QNTAAILTTFNEIDMKNVMDLRTKYKDAFEKKYGIKLGFMSFFIKAAVQALKEIPEINAE
ISGDEIIYKHYYDIGVAVGTDKGLVVPVIRSADQMSFAEIELTLVALGKKAREGKLQVSE
MEGATFTISNGGVYGSLLSTPIINPPQSGILGMHSIQNRPVAVGNAVEIRPMMYIALSYD
HRIVDGKGAVTFLVKIKNYIEDPNRLVLEV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaattatagaaatcagagcaccaaaaactcttggtggtgaatcagttacagaa
ggtatagtaaaaataaagaagggtattggagaagcagtaaaagtagatgatctgattttt
gaaattgaaactgacaaaacagcactcgaattaactgcagaagcttcagggcaaataact
gaatttcttgtaaaggaagatgatgtgataagtcctgatcaattgttagcgaagctttcc
gtgggagaagtaaaagaggaagcgaaaaaagaagataaaagcgaaagtgctgctaaaaaa
gatgctccatcagctcgtaaaattatggaagaaaatgcaatcagtgcagaaagcgtcaaa
ggaactggcatgggaggcagaataacaaaagcagatgtgataggccatatgaacaaagct
gaacaacctgcaataaaacaatatgaattgccaaaaagtgtagtaaatggagagcaaaga
gaggaacgagtaaaaatgagcaaaataaggcaagtaattgccgctcgtttgaaagcatcg
caaaatactgctgcaatactgaccacgttcaatgaaattgacatgaagaatgtcatggat
ctaagaacgaaatataaggacgcctttgaaaaaaaatatggaataaaacttggttttatg
tcgttttttataaaggcagcggtgcaagcactgaaagagattcctgaaattaacgctgaa
atctcaggcgatgaaatcatatataaacattactatgacataggtgttgctgttggcact
gacaaaggccttgttgtgccggttattcggagtgccgatcagatgtcatttgccgaaatt
gaattgactttagttgctcttggcaaaaaagcacgagaaggtaaattacaagtatcagaa
atggaaggtgcaacatttaccatttcaaatggcggagtatatggttcgctcctttctact
ccgataataaatcctccgcaatctggaatacttggaatgcattcaatacaaaacaggcca
gttgctgttggtaatgcagtagagatcagacctatgatgtacattgctctttcttatgat
cacagaatagttgatggcaaaggagcagtgactttcctcgttaaaataaaaaattatata
gaagatccaaataggttagttttggaagtgtag

DBGET integrated database retrieval system