KEGG   Wolbachia wRi (Drosophila simulans): WRi_004350Help
Entry
WRi_004350        CDS       T00866                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
wri  Wolbachia wRi (Drosophila simulans)
Pathway
wri00450  Selenocompound metabolism
wri00970  Aminoacyl-tRNA biosynthesis
wri01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wri00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    WRi_004350
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    WRi_004350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:wri01007]
    WRi_004350
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:wri03016]
    WRi_004350
Enzymes [BR:wri01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     WRi_004350
Amino acid related enzymes [BR:wri01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   WRi_004350
Transfer RNA biogenesis [BR:wri03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    WRi_004350
 Prokaryotic type
   Other AARSs
    WRi_004350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ACN95227
UniProt: C0R2T5
Position
complement(467460..469106)
Genome map
AA seq 548 aa AA seqDB search
MEQFENFYITTPVYYVNDKPHIGHAYTSLLCDVVARFMKLAGKNVKFTTGTDEHGQKIEK
AAKAKEMQPKEFTDDVSVSFKELAKFMNFEYDDFIRTTEERHKKAVIALWNRLEERGQIY
LDSYSGWYSVRDEAFYQESELIDGKAPTGAEVQWIKEESYFFRLSNWQDKLLELYKNQPS
FIFPESRRNEVISFVRSGLIDLSISRTSFNWGIKVPGNDKHVIYVWIDALTNYLTSIGFP
STEGEEYKRFWAEPETQIPVSSTGMTPNQGKTQIPVSSTGMTPNLADNSFNVHVIGKDIL
RFHAVYWPAILLAADLPLPKQIAVHGWWLNEGEKISKSLGNVIDPIGLAQEFGVDQLRYF
LLREASFGQDGNFSKKNMISRINSELANNIGNLVQRTISFLHKQCSGIVPTIDQILLKGE
ESLPGCKAILDQVMNHLSKYEFNHIILLIINISSEANAYIDKSAPWTLSKTDRERVNLVI
YKLLEYIRIIGILLQPIVPKSAEMILNQLQIPKEQRDLKSLCNACVSLGITLPKPTPVFL
RVDAKEEK
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggaacaattcgagaacttttacatcaccacgccagtatattacgtaaacgataagccg
catattggtcatgcatacacttctctcttgtgtgacgtggtggcaaggttcatgaaacta
gctgggaaaaatgtcaaatttaccaccggtacagatgaacatggacaaaaaatagaaaaa
gcagctaaagcaaaggaaatgcagccaaaagaatttacagatgatgtgagcgtttcattt
aaagaattggctaagttcatgaattttgagtatgacgattttattcgcactacggaggaa
cgtcacaaaaaagcagttatagctttatggaatagacttgaagagagagggcaaatatat
ttggattcctattcgggttggtattcagttcgtgatgaagcattttatcaggaatcagag
ctgatagatggcaaagcaccaacaggcgcagaagttcagtggataaaagaagagagctac
ttttttcgcttgtcaaactggcaagacaaattactggaactctataaaaatcagccaagt
tttatctttcctgagagcagaagaaatgaagtgatatcgtttgtaagatcagggctcatt
gacctctcaatctctcgcactagttttaactggggaataaaagtaccaggtaatgacaaa
cacgtaatctatgtctggatagatgcattaaccaattatcttacatcaataggtttccct
agtactgaaggtgaggaatataagaggttttgggcagaaccagaaacacagattccagtg
tcaagcactggaatgacaccaaaccaagggaaaacgcagattccagtgtcaagcactgga
atgacgccgaacctagctgacaactctttcaacgttcatgtaatcggtaaagacatattg
cgctttcatgctgtatattggccagcgattctccttgcagcagacctgccactgccaaaa
caaattgcagttcatggttggtggttgaacgagggagagaaaatatccaagtcccttggt
aatgtcatagatccaattggcctcgctcaagagtttggtgttgatcagctacgctatttt
ctcctcagggaagcaagcttcggccaagatggcaactttagtaagaaaaatatgatcagc
cggataaattcagaactggcaaacaacataggcaatttagtgcaaagaacaatttcattt
ttacacaagcaatgttctggaattgtaccaacaatcgatcaaatcctacttaaaggtgaa
gaaagtcttccaggttgcaaagctatactcgatcaagtgatgaatcacctatcaaagtat
gaatttaaccatatcatacttctaatcatcaacatctcttctgaagcaaatgcctacata
gacaaaagtgcaccctggacactaagcaaaactgacagagagcgcgtgaatttagtaatt
tacaagttactggaatatatcaggataataggcattttattgcagccaatcgttcccaag
tcagcagagatgatactaaatcaactgcaaattccgaaagaacaacgagatttaaaatct
ctgtgcaacgcatgcgtaagcttaggcattacgctgcctaaacctacgccggtttttttg
agggttgatgctaaagaggagaaatag

DBGET integrated database retrieval system