KEGG   Wallemia mellicola: WALSEDRAFT_30873Help
Entry
WALSEDRAFT_30873  CDS       T03142                                 

Definition
(RefSeq) aromatic amino acid beta-eliminating lyase/threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
wse  Wallemia mellicola
Pathway
wse00260  Glycine, serine and threonine metabolism
wse01100  Metabolic pathways
wse01110  Biosynthesis of secondary metabolites
wse01130  Biosynthesis of antibiotics
wse01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:wse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WALSEDRAFT_30873
Enzymes [BR:wse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     WALSEDRAFT_30873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18471201
NCBI-ProteinID: XP_006955972
JGI: Walse1_30873
UniProt: I4YJK5
Position
Unknown
AA seq 346 aa AA seqDB search
MSVCQQLENIARDFRSDTLTAPTDGMLSYAFKASRGDDVYEEDDSTNEFQAKFAELTGKQ
DALFCISGTMANQIGLRTNLQQPPHSVICDSRAHIYRFEAGGVAYHSQAQVIPVTPSNGH
HLTLEDIQKAAVIDENIHYATTRVIALENATGGLIYPQEEIKRISEWAHANGLLMHLDGA
RLWNVHIATGLSVKELCEPFDSVSVCLSKGLGATIGSVLVGSKSFIKKATWFRKLFGGGV
RQCGFVVAAADYALQHNLPLIERSHQLAKRLSIGLENAGVKILSPVESSMVFYDPTSLGV
SSQEFNTRAKAAGITLRPGRIVLHFQNTDDAIDKLVAVAESFSKQH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgtgtcaacaactcgaaaacatagctagagatttcagatctgacactctcacc
gctcccacagatggcatgctttcctacgcctttaaagcgtcccgcggtgacgatgtatac
gaggaggatgactctactaatgaattccaagccaaatttgctgaactcaccggcaagcaa
gacgctttattctgcatttctggtaccatggctaatcaaatcggtttgaggacaaatctt
caacagcccccacatagtgtcatttgtgatagcagagcccatatttaccgttttgaagca
ggaggtgtagcctatcattctcaagctcaggtcataccggtcacaccgtcgaatgggcat
catcttactttagaagacattcagaaggctgctgtcatagatgaaaacatacattatgct
accacacgagtcattgctcttgaaaatgccacaggtgggcttatatacccacaagaagag
ataaagaggataagtgaatgggctcatgctaatggtttacttatgcaccttgacggtgct
cgactctggaatgttcatattgcgacaggattatcggtcaaagagctatgtgagccgttt
gactctgtcagtgtctgcttgagcaaaggtttaggtgctactatcggcagtgtactagtc
ggaagcaagtcttttattaaaaaggcaacttggtttagaaaactttttggtggtggtgtc
cgtcagtgtggattcgtggttgctgcagctgattatgctcttcagcataacttgcctctg
attgagaggtcccatcaactggcaaaaaggctctctattggacttgaaaatgctggcgta
aagatattatcaccagttgagtcttcaatggtcttctacgatcctacatcgcttggtgta
tcttctcaggaatttaatacacgtgcaaaagctgctggtattacactacgtccaggcagg
atagtcttacacttccaaaacactgacgatgccattgacaaactggttgctgtcgcagaa
tctttcagtaaacaacattag

DBGET integrated database retrieval system