KEGG   Wallemia mellicola: WALSEDRAFT_34405Help
Entry
WALSEDRAFT_34405  CDS       T03142                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
wse  Wallemia mellicola
Pathway
wse00450  Selenocompound metabolism
wse00970  Aminoacyl-tRNA biosynthesis
wse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    WALSEDRAFT_34405
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    WALSEDRAFT_34405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:wse01007]
    WALSEDRAFT_34405
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:wse03016]
    WALSEDRAFT_34405
Enzymes [BR:wse01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     WALSEDRAFT_34405
Amino acid related enzymes [BR:wse01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   WALSEDRAFT_34405
Transfer RNA biogenesis [BR:wse03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    WALSEDRAFT_34405
 Prokaryotic type
   Other AARSs
    WALSEDRAFT_34405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS tRNA-synt_1 Anticodon_1 DUF5601 Sds3
Motif
Other DBs
NCBI-GeneID: 18471860
NCBI-ProteinID: XP_006955748
JGI: Walse1_34405
UniProt: I4YIW5
Position
Unknown
AA seq 691 aa AA seqDB search
MTSVNEQVLRKLVEKDKVILPKDNEDNILISSALPYCNNVPHLGNVIGSTLSADVFARYN
RIRNRNTLYICGTDEYGTATETKAIEDGITPKELCDKYTAIHKEVYDWFEIEFDKFGRTS
TDKQTEIVQDFYKNIRKNNLLVKSTKEQIYSVEEDKFLADRFVEGTCPYCQADDARGDQC
DKCSRTFDSPLELLNPRSKMNPKSQLVTRPTAHMYLDLGKLQPALESWLKDTASQHNWPG
NIVINSDREIVEARMKAGLQPSAITRDLKWGVPVPAIGDPEEDAEMAGKVMYVWMDAPIG
YISITANYTDEWQKWWLNPKNVNYYQFMGKDNVYFHLCFFPSLLVADGRDWTRLKYISST
DYLQYEGGKFSKSKGVGVFGNSAKETGISPSVWRFFLLSRRPESGDTEFTWNEFIGANNN
HLLKNFGNYVNRVLKFTAAKFDSTIPGEAEDVNLQYSDDTDFEERKNSFVKDINEVLTRY
IDSMERANLRSGLDDVLALSRRGNEWIQENKLDNALLAENPRRAQRTVLVAANLIYIISA
AIHPFMPSTSESIINQLDAPARTLPESFAIDLYPGHKIGTPSILFTRIDEKMEDVWRQKF
GGSQDGQPKAPELSKKQLAKQAKAAKAAKETAKVPDTPEAKALNDSITAQGNRIRDIKSG
AIKDADLGKEVAQLKQLKNDMDVMIKKLESL
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgacttcggtaaacgagcaagtgctcagaaaattagttgaaaaggacaaagtaatactt
ccaaaggataacgaagataatatccttatctcatctgctctgccttattgtaataacgta
ccacatttgggtaacgtaattggtagtacactctcagcagatgttttcgctagatacaac
agaattagaaatcgcaatacactctacatttgcggtacagatgaatacggtacagcaact
gagacgaaagctatcgaggatggcataacacctaaggagctttgcgataaatatacagcc
attcacaaagaagtttacgattggttcgagattgaattcgataaatttggacgcacttct
actgataagcaaacagaaattgtacaagatttctacaaaaatatcagaaagaataacctt
ttggtaaagtcaacgaaggagcaaatttactctgttgaagaagacaagttcttagcagac
agattcgttgaaggtacttgtccatattgtcaagctgacgatgcccgtggtgatcaatgt
gacaaatgttcacgcacttttgatagtccactcgagttgctcaacccaagatcaaaaatg
aatccaaaatcacaacttgtcactcgtccaactgcacatatgtaccttgacttgggtaaa
ttacagccagctctcgaaagttggttgaaagacactgcttctcagcacaactggcctgga
aacattgttatcaactcggatagggagattgttgaggcaagaatgaaagcaggtcttcaa
ccatcagcgatcacccgtgacttaaagtggggtgtcccagtcccagctataggtgaccca
gaggaagacgctgagatggccggaaaggttatgtatgtctggatggacgctccaattgga
tacatctccatcacagccaattataccgatgaatggcaaaaatggtggttgaatccaaag
aatgtcaattattaccaattcatgggtaaagataatgtttacttccacttgtgtttcttc
ccttcactcttagtagctgatggacgtgactggactagactcaagtacatttcttcaacg
gattacctccaatatgaaggcggaaagtttagtaaatctaagggagtaggtgtattcggt
aacagtgcaaaggaaactggaatttcaccttctgtttggagattcttcttgctcagtcgt
cgtccggaatctggtgacactgaattcacatggaacgaattcattggagcaaacaacaat
catttgctcaagaattttggtaactatgtgaacagagttctcaaatttactgctgccaaa
ttcgacagtactataccaggagaagctgaagatgtcaatctccaatactccgatgacact
gactttgaagagcgcaaaaatagcttcgttaaggacattaatgaggttcttactagatat
atcgattctatggaacgcgctaacttgcggtctggcttggatgatgttttggctctctct
agaagaggtaacgagtggatccaggagaacaaactcgataatgcacttttagctgaaaat
cctcgcagagctcaaagaactgtattggttgctgctaacctcatctatattatcagtgca
gctatccatccattcatgccttcaacctcagaatcaatcatcaaccaattggacgcacct
gcacgtacactccctgaatcatttgctatcgatctctacccaggtcataagatcggaaca
ccaagtatcttgttcacacgtatagacgagaagatggaagatgtatggagacaaaagttc
ggcggaagtcaagatggacaaccaaaggcaccagagctgtcgaagaagcaacttgctaag
caagcaaaggcagcaaaagcagcaaaagaaacagccaaggtacctgatacacctgaagca
aaggctttgaatgacagtatcactgctcaaggtaatcgcatccgtgatatcaaatctgga
gcaatcaaggatgccgatcttggcaaagaggtcgcgcaattgaagcagttaaagaatgat
atggacgtcatgatcaaaaagttagaatcattgtaa

DBGET integrated database retrieval system