KEGG   Wallemia mellicola: WALSEDRAFT_36235Help
Entry
WALSEDRAFT_36235  CDS       T03142                                 

Definition
(RefSeq) hypothetical protein
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
wse  Wallemia mellicola
Pathway
wse00051  Fructose and mannose metabolism
wse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    WALSEDRAFT_36235
Enzymes [BR:wse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     WALSEDRAFT_36235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-GeneID: 18471952
NCBI-ProteinID: XP_006957150
JGI: Walse1_36235
UniProt: I4YGM5
Position
Unknown
AA seq 476 aa AA seqDB search
MTQITGYSTHDIRFPTSLSGDGTDAMNTDCDYSAAYIIIHTTSESLKGYGMTFTIGKGND
IVVQAIKQLADKLVNKPIESLFNDMGAMWALLVSDSQLRWLGPEKGVIGIATGAVSNAVW
DLYARSRKKPLWKLIVDMSPEEIVRSSSLRYISDALTPEEAVEILRERQSTKQDREENAV
KHGLKAYSTSVGWMGYTTEKVQRLTKEALQQGFDHFKLKVGVSVDDDLARAKTIRDIIDD
PQYQRSDKQVNLKALENKNAGPTGNVLMIDANQVWDVKEAVSYVKKLQPCKPWFIEEPTM
PDDVLGHARIRNELKDTGIGVATGEHCANRVLFKQLLQAEAIDVLQIDACRLAGLNECLA
VMLLAAKFNVPVCPHAGGVGLCEYVVHLSLIDYIYMAPSFDRNVVEWVDHLHEHFRYPVS
VNSNGRYNAPTGPNVGYSIEMYQDSIERYSYPNGSYWKDEHPRLVNKAQEGRRVIG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaatcactggctattctacccacgatatacgctttccaacgtctttatctggt
gatggtacagacgcaatgaacacagattgcgactattctgcagcttacattattatacat
accactagtgaatccctcaaaggctatggtatgacattcacgataggaaagggcaatgac
atcgttgttcaggctatcaaacaactcgctgacaagcttgtaaataagcctatagaaagt
ctattcaatgatatgggtgcaatgtgggcacttttagtttccgatagtcaattaagatgg
cttggtcctgaaaagggtgttattggtattgctactggggctgtatcgaacgcagtttgg
gatttatacgctagatcacgcaaaaaacctctttggaagcttattgttgatatgtctcct
gaagaaattgtcagatccagttcactgagatacattagtgacgctcttacacctgaagag
gcggtagaaatactaagagaaagacaatcgacgaaacaagatagggaagaaaatgctgtt
aaacatggtttaaaagcctattcaactagcgttggctggatgggctacacgaccgaaaaa
gttcagcgtctgacaaaggaagctctccagcaaggctttgaccatttcaagctcaaagtt
ggcgtttcagtagacgatgatctcgctagagctaagactataagagatataattgatgat
ccacaatatcaacgttcagataaacaagtaaatctgaaagcattagagaataaaaatgca
ggacctacaggcaacgttcttatgattgatgcaaaccaagtttgggatgtcaaagaggca
gtttcatatgttaaaaagcttcaaccttgcaaaccttggtttattgaagaacccacaatg
ccagacgatgtacttggacacgctcgtattcgcaacgaattaaaggatactggtataggt
gttgcaactggtgaacactgtgcaaatagagtacttttcaagcaacttctacaggctgag
gctatcgatgtcttacaaattgatgcttgtcgtcttgcaggtcttaatgagtgcttggca
gttatgcttttagctgctaaatttaacgtacctgtttgtccacatgctggaggtgtcggt
ttatgtgaatatgtcgtacatttatctctcattgattatatttacatggcgccatctttc
gacaggaatgtggtagaatgggtcgatcatcttcatgaacactttagatatccagtcagc
gtgaactcaaatggcagatataatgcaccaacaggtccaaatgttggctacagtattgaa
atgtatcaagatagtattgaaagatacagttatccaaatggatcctactggaaagatgag
catccaagacttgtaaacaaagcgcaagaaggaagaagagtgattggttag

DBGET integrated database retrieval system