KEGG   Wallemia mellicola: WALSEDRAFT_37478Help
Entry
WALSEDRAFT_37478  CDS       T03142                                 

Definition
(RefSeq) hypothetical protein
  KO
K12733  peptidyl-prolyl cis-trans isomerase-like 1 [EC:5.2.1.8]
Organism
wse  Wallemia mellicola
Pathway
wse03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:wse00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    WALSEDRAFT_37478
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:wse03041]
    WALSEDRAFT_37478
   03110 Chaperones and folding catalysts [BR:wse03110]
    WALSEDRAFT_37478
Enzymes [BR:wse01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     WALSEDRAFT_37478
Spliceosome [BR:wse03041]
 Complex B
  Other components
   Prp19-related factors
    WALSEDRAFT_37478
 Complex C
    WALSEDRAFT_37478
Chaperones and folding catalysts [BR:wse03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    WALSEDRAFT_37478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 18472018
NCBI-ProteinID: XP_006957821
JGI: Walse1_37478
UniProt: I4YDH0
Position
Unknown
AA seq 160 aa AA seqDB search
MATVVQLKTSQGDIDLELYVNHAPKTCNNFSQLVQRGYYNGVVFHRIVQDFMIQGGDPTG
TGRGGTSVYGGKFEDEINPELRFTGAGILAMANSGPNTNGSQFFITLSPTPYLDGKHTIF
GRVLRGMRVVQRMGNVVVDKADRPIEDVKIYNASIQQMIE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgttgtacaactcaaaaccagtcagggtgatatcgaccttgaactatacgtt
aatcacgcaccaaaaacttgcaacaatttcagtcagttagtacaaaggggttactacaat
ggtgtagtattccacagaatagttcaagactttatgatacagggaggtgatccaacagga
actggtagaggtggtacatctgtctacggaggaaaattcgaagatgaaataaacccagaa
ttaagattcacaggtgcaggtatactagcaatggcaaactcaggtccaaacacaaatggt
tctcaattctttataacactatcaccaacaccatatctcgacggaaaacacacaatcttt
ggaagagttctaagaggtatgagagtcgtacaaagaatgggtaacgtcgtagtagacaaa
gcagacagaccaatagaggatgtaaaaatatataatgcctcaatacagcaaatgattgag
taa

DBGET integrated database retrieval system