KEGG   Wallemia mellicola: WALSEDRAFT_52480
Entry
WALSEDRAFT_52480  CDS       T03142                                 

Definition
(RefSeq) ERG4/ERG24 ergosterol biosynthesis protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
wse  Wallemia mellicola
Pathway
wse00100  Steroid biosynthesis
wse01100  Metabolic pathways
wse01110  Biosynthesis of secondary metabolites
Module
wse_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:wse00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    WALSEDRAFT_52480
Enzymes [BR:wse01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     WALSEDRAFT_52480
SSDB
Motif
Pfam: ERG4_ERG24 PEMT DUF1295 ICMT
Other DBs
NCBI-GeneID: 18472585
NCBI-ProteinID: XP_006960039
JGI: Walse1_52480
UniProt: I4Y7F5
Position
Unknown
AA seq 431 aa
MTKVSKGEEINPKTTQYSFFGPLGTGAITLLTPAITYLLYFACPNSYDDDTCQLLQKPAF
ERLLECDFWKSLFDLEAFGVYLAWYTFTVVAWAIIPAQWVRGTQLRDGTYKLYKMNAFAT
LLMATGIAIGQIVRAGPEGFTYLADKWIPILTASLIMSVAQSVFCYAMSFTSGKLLALGG
NTGSFVHDFFIGRELNPSIGSFDIKTFNELRPGLALWWLLDISLACRQYATFGRLTDSMI
LVVGFHGWYVFDALYNEPIILTQMDIVHDGFGFMLAFGDLTWVPFVYSLQARFLAYHPNV
LGPLGVFAVVLLQLLGYYIFRVSNAEKNDFRNGKNPKNLQYMQTKRGTKLLTSGWWGTLR
HPNYLGDLIMAVAWSLPTGGCTPLTYFYPAYFTVLLIHRALRDDSHCREKYGDDWNAYIE
KVPYCIFPYSE
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgacgaaagttagtaaaggagaagaaatcaatcctaagacaacacagtatagcttcttc
ggcccactcggtacgggtgctataacgttactcacgcctgctataacctacctgctttac
ttcgcatgtccaaactcgtatgatgatgatacatgccaacttttacagaaaccggcattt
gagaggcttttagaatgcgacttctggaaatcactctttgatttggaagctttcggcgta
taccttgcttggtacactttcactgtcgttgcatgggctatcatacctgcacaatgggta
cgcggtacacagctccgtgatggtacttacaagctctataaaatgaatgctttcgctaca
ttgcttatggctactggtatcgctatcggacaaatcgttcgcgctggtcctgaaggattc
acttaccttgctgataaatggataccaattcttactgcctcacttatcatgtcagtcgct
caatctgtcttctgctacgctatgtcattcacttccggcaaattacttgctctcggtggt
aacaccggcagctttgtacatgatttcttcatcggtagagaactcaacccttcaattggt
tcatttgatatcaagactttcaatgaacttagaccaggtttggcactttggtggctcctt
gatatttctctcgcttgcagacaatacgcgacattcggccgtttgactgactcaatgatt
ctcgtagttggtttccacggctggtacgtctttgacgcattatacaatgagccaattatc
ctcactcaaatggacatcgtccacgatggtttcggtttcatgttagcatttggtgatctc
acttgggtacctttcgtgtactcccttcaagcaagattcttggcttaccatccaaacgtt
ttgggcccacttggcgttttcgctgtcgtcttattacagctacttggttactacattttc
cgtgtctcaaacgcagaaaagaacgatttcagaaacggcaagaatccaaagaatctccaa
tacatgcagacaaagagaggcactaagctcttgacttctggatggtggggtactctcaga
catccaaactaccttggcgatttgataatggctgtagcatggagtttgccaactggtgga
tgtacaccattgacttacttctaccctgcttacttcactgtcttgctcattcacagagca
cttcgcgatgattcacactgtagagagaagtatggtgatgactggaacgcctacattgag
aaagttccttactgcatcttcccttacagtgagtaa

DBGET integrated database retrieval system