KEGG   Wallemia mellicola: WALSEDRAFT_60163Help
Entry
WALSEDRAFT_60163  CDS       T03142                                 

Definition
(RefSeq) carbon-nitrogen hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
wse  Wallemia mellicola
Brite
KEGG Orthology (KO) [BR:wse00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WALSEDRAFT_60163
Enzymes [BR:wse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     WALSEDRAFT_60163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 18473782
NCBI-ProteinID: XP_006957892
JGI: Walse1_60163
UniProt: I4YDP6
Position
Unknown
AA seq 291 aa AA seqDB search
MTIAAVAQICSRQNVKDNALKCVSLIKRAADNGAKAIFLPEASDFIAQGDLYKTLSEPLS
TSSFLNDIRAAAISSRIWVSLGLHEGGASDDRCFNTQVMIDDKGDILSSYRKTHLFDVKD
VGPGNKPVLESMSTEPGKHIEEPIQTPVGMLGMLTCYDIRFPEVSLMLRSRGAQVLTYPS
SFTVKTGKAHWETLLRARAIETQCYVIAAAQAGVHTTAGRTSYGRSMVVSPWGEIVTQLS
TYDNIPSPFEKEQDMPDTSSEIAYFDIDLDYLNNVRASMPLWQQRRQDVYD
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgctgctgttgctcaaatatgtagccgtcagaacgtcaaagataatgctctg
aagtgcgtatctttaataaaaagagctgcagataatggcgctaaggcaatattccttcca
gaagctagtgacttcatcgcccagggggatctctataagacactatctgaaccactatct
acgtcatctttcttaaacgatatacgtgcagctgccataagttcacgcatttgggtctca
ctaggtttacatgagggtggtgcatctgacgatcgctgttttaatactcaggtgatgatt
gacgataagggtgacattctttctagctacaggaagacacatctcttcgatgtaaaagat
gtcggaccgggaaacaaacccgtactagaaagcatgtctaccgagcctggaaagcatata
gaggaacctatacagactcccgtcggaatgctcgggatgttaacttgctatgatataaga
tttccagaagtcagcctgatgttgagaagtcgtggcgcacaggtgctcacttacccaagc
agcttcactgtaaagactggaaaagctcactgggaaactctcttacgtgcacgcgctatt
gagacacaatgttatgtcatcgcagctgcacaagcaggcgttcataccacggctggtcgc
acatcatatggtagatcaatggtggtcagcccgtggggtgaaatagtgacgcagttgagc
acatacgataacattccatctccattcgagaaagagcaggatatgccggacacatcctcc
gaaattgcgtactttgatattgacttggattatttgaacaacgtgcgcgcttctatgcct
ctctggcagcaacgtagacaagatgtatatgattag

DBGET integrated database retrieval system