KEGG   Wallemia mellicola: WALSEDRAFT_60488Help
Entry
WALSEDRAFT_60488  CDS       T03142                                 

Definition
(RefSeq) hypothetical protein
  KO
K02365  separase [EC:3.4.22.49]
Organism
wse  Wallemia mellicola
Pathway
wse04111  Cell cycle - yeast
wse04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:wse00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    WALSEDRAFT_60488
   04113 Meiosis - yeast
    WALSEDRAFT_60488
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:wse01002]
    WALSEDRAFT_60488
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:wse03036]
    WALSEDRAFT_60488
Enzymes [BR:wse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     WALSEDRAFT_60488
Peptidases [BR:wse01002]
 Cysteine Peptidases
  Family C50: separase family
   WALSEDRAFT_60488
Chromosome and associated proteins [BR:wse03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    WALSEDRAFT_60488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 TPR_MalT CHAT TPR_21
Motif
Other DBs
NCBI-GeneID: 18473980
NCBI-ProteinID: XP_006958586
JGI: Walse1_60488
UniProt: I4YB88
Position
Unknown
AA seq 2090 aa AA seqDB search
MASAASRKTATRMPSRTKLTSNNTNQTMIQPHEFVDRLLDLSNCTDNLHKQLTMTLQAKQ
STRTDTLPKSERATLALRSCNACLKSFSSVSRSPTKDGLKMENLPHLIASARLSLATLRE
LEESLPTKAVDICRATLKCVEECNLLGFTKSALLELIALHPFLCRQLSNETSTPVQIPPN
KPQGILVHVIPKEKIPVDLASVQLLYYQLSIRILLSLPNIDLLAMSSALSINGSLISQLP
SLRQSLQMEPYANGTTTLFKLLCRATTEQEKPSSSTALIHFKIRSKALMLINHNHNLDLN
LWWTQGWKFGLSLLRSAEDALVPYTNVVKPFWSNMIEFAQARNQSRFMEGKGWIDFCEGW
MSIAKKLDDISSLQLIAKLLSNDTNNSNEDTDELASDLSALTLSADKESLFTKYNVILLT
TTAKLSSKSSLDDLKDRDYSNIIHVLDSLKHLDLDDIMFCKAERNVDGIRRVIYNRIAEM
GEMNPQCEKLCVLQSYLALWTEHQLQKSRSLSPPLLYGTLDSLLQLAQLRVNDSTESMNY
LNRALAFIEPLKSPQANRLVASAFWNWSCTLFQDGKAGTEADCIPAVESCLKVAEDGIAM
CNETIARHPNDGFKGDQEMLKIMIDQRPKRYELLAICYSKVHDNQSAYEAFCNSILSSLQ
TTSSPINREIDKLDDSHSYSILVKKAMQIGLSRLMLPPQDLSLCARAEKLNIDQDVKCTL
IELQIRQIEERAWSDQNASSAVIHMILELIGSAGYDISRNPLKKARILLRLMEQIVLGPS
VDLEGIHIPAVEVLFEEVRSCVQREDYVEDTSLKTSTMSFMLSAHMFLAIYYYRSSDTPL
EGSSSALREARHTKEILKTILGTGGPRRSSILRDNNLRASSTQNQTREINNPSSKTRSVS
TRQTTTTRVTRSRQVPASQTSKAPTGRATRPTAATRRVVKPATTISKSLKSNDDVKSTDS
NNNQFDDIERCYNSLRLLTEMLGILGHTFLRLDFLKLLRKICQSQQRKSENKCEDYLLAS
TTLAAEYVKIGKISRAGAVFAQVASMKEVPANKTSVSWISSQIEFNLRYSEYLAITENHE
KSIMAYNDAFVLKELLDSTIEKDSQKNPLSRTLQCERVAIAASVYSKIAYYREDVPTTLK
YLAQALRLYNNAARHISKLTPKRESRSMRDDNDPFSMEVDEPNESQSSPHLNVFENRKCT
GIHWRISQSLLDCLILLSSIYTSRGSSREAEFFLGQANNLTETLASPNFDAKINAAKAEL
NLALNDLDQSKKDIDKALYSLGGQDDTESSVLIKKAKGDLQFRLESNADASAGYLSACLI
LERLDKVYNEIETSTTSPKKSNNDFVNDATIYDPILPEIFGHLLRQRIWLLSEDEKNAES
QKLLDKLFNFPTNSINKAEENLLLGKMRLREAYNSFQSDLFMSSLSDALISVPCGSVVNG
HDSNSLNSRQPSIETLADAEKFFMSALELNIDKTSIKDIRQACLGIALIKSFQTSLGKVS
KNNSRLAATYLDLGSAVTLRRELLEVIDNKLSHSESRNDMDWPGIDQLNQIKSLSPHKRN
SKRLFIPSPSPLGSPMHESENLFNEDLSINKYWEDIKSRHLREFNNPEEGLVETINQLPN
NYSVISISITDDKKTMFVVKFRKNSEPLLVSLPLDNRQNKREGGGEEGAFTYRDAIDELQ
SIIEESDKSIKSASDGQVITDDDKVDWWNCRKHLDSRMRQFVKNIEFCWLGVFKSLFLKP
TAKSENALNGLRGCLEKVFKRHIHSNGRKRLNSKVKLDDALLECFSALQTNCKDEELEDL
IYFVLDIHGFHGIQLALAEIDIDQATVDIRSALEEYSNKFSDDNQVEDDQHTFIILDKMT
QTMPWESIPTLRNQSVSRIPSIGFLRDRMDLIKHLHQDKFYVNPKKTFCLINPSGDLKRT
QKNFEGWFTKLKEIGWKGITGREPLEVEIANALETNDLFIYFGHGGGQKYIRSQKIRNLK
KCATTMLWGCSSGSLKSTGDFDSYGNPTNYLLAGCPSLVANLWDVTDRDIDRLSQSVFDK
LGLNYDSISNNKCQDSITITEAIASSRKDCRLKYLTGSAVVVYGIPIQLR
NT seq 6273 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgcagcaagtaggaaaacagcaacgcggatgccatctcgcacgaagttaacg
tctaataatacgaaccaaactatgatacaaccccatgagtttgtcgacagattgctagat
ctctcaaactgcacagataatctacacaaacagttaacaatgaccttacaagcgaaacag
tctacacgtacggatactttaccaaagtctgagcgtgctactttggctttgaggtcatgc
aacgcttgcttgaaatcgttttctagtgtctcgagatctccaactaaggacggtttgaaa
atggagaatctgcctcatttaattgcatctgctagactttcactcgccacattacgtgaa
ctcgaagaatcattacctacaaaggcggttgatatttgtagagcaacgttaaaatgcgtt
gaggaatgtaaccttctgggatttacaaaatccgctttgctagagctcattgcattgcat
cctttcctctgtcgtcaactatctaatgaaacatcaacaccagtacagattccaccaaac
aagccacaaggtatactggtccacgttatccctaaagaaaagattccagttgatttggcc
agtgtacaactactttattatcagttatcaatacggatacttctctcgttaccaaatata
gatctactggcaatgtcgagcgctttaagtatcaacggttcgctcatatctcaattacct
tcacttaggcaatctttacaaatggagccatacgcgaatggaacaactacattgtttaag
ctattatgtagagcaactacagagcaagaaaagccatcatcttcaactgcacttattcac
tttaaaattaggtctaaagctttaatgcttatcaatcataatcataatttagatctcaat
ttgtggtggactcaaggctggaagtttggtttatctttattgagatcagctgaagatgct
ttggtaccttacacaaacgtggtgaaacctttttggtctaacatgatcgagtttgcacaa
gcgcgtaatcaatctaggttcatggaaggaaaaggatggatagacttttgtgaaggctgg
atgagtattgctaagaagctcgatgatatctcttcattacaactgatagcaaaattactt
tcaaatgatacaaacaactctaacgaagatactgatgaacttgcatccgatttgtcagca
ttgacactgtcagctgataaagagagtctatttacaaaatacaatgtaatactgttaaca
actactgcaaaattgtcatcgaaatcaagccttgacgatttgaaagatcgcgattattcg
aatatcattcacgtactcgactctttgaagcatctagatctagatgatattatgttttgc
aaagctgaaagaaatgtcgatggtatacgtagggtaatttataacagaatagctgaaatg
ggagagatgaatccacaatgtgaaaaactctgtgtattacaaagttatttagctctttgg
acagaacatcaactacagaaatcaagatctttatcacctccgttactttatggtacatta
gattctttattacagttagctcaacttagagttaatgacagtacggaatcaatgaattat
cttaatagagctctagcctttattgaaccgttgaaatcaccacaagctaacagattggtt
gcgtcagcattttggaattggtcgtgtacattattccaggatggcaaagcaggtacagaa
gcggactgtataccagcagttgaaagctgtctgaaagttgcagaagatggtatcgctatg
tgcaatgaaacaatagcaagacatcccaacgatggatttaaaggtgatcaagagatgttg
aagataatgatcgaccaacgaccaaaacgctatgaacttttggctatatgttactcaaag
gtacatgacaatcaatcagcatacgaagctttctgcaactcaattttgtcttcattacaa
actacttcatcaccaatcaatagagagatagacaagcttgatgattctcatagctattca
atactcgtaaagaaggctatgcagattggtctatctagacttatgttaccaccccaggat
ctgtctttatgtgctcgcgctgaaaaattaaacatcgatcaagacgttaagtgcacatta
atcgaactacaaatccgtcaaattgaggaacgcgcttggtccgatcagaatgcttcttct
gcagttatccatatgattttggaattgattggatcggctggttatgatatatcgaggaat
ccactaaaaaaagcgagaatacttttgaggttgatggaacaaattgttttgggaccttca
gttgatcttgaaggtattcacattccagctgttgaagttctatttgaagaggttaggtcg
tgtgtacaacgggaagattatgtggaagatacatcattgaagacatctactatgagtttt
atgttgtcagctcatatgttcttagcaatttattattatagatcgagtgatacaccatta
gaaggatcatcctcagctttgagagaagcaagacacacaaaggagatcttaaaaactatc
ttaggtacaggtggacctagaagaagctccattctgcgggataacaatttaagagcatct
tcaactcaaaatcaaacgagagaaatcaataatccatcatcaaagactagaagtgtttca
acgagacaaactacgactactagagttacgcgtagccgtcaagtaccagccagtcaaact
tcgaaagcgccaacaggccgtgcgactagacctacggcggctacgaggcgagttgtaaag
ccagcaacaacaatatcaaaatcacttaagtctaatgatgatgtcaaatctacagattcg
aataataatcaatttgatgatattgagagatgctataattctctgagattattgactgaa
atgcttggtattttaggtcatacgttcctcagactagactttctaaaactacttcgtaaa
atctgtcaaagtcaacaaagaaaatcagaaaacaaatgtgaagattatttacttgcatca
acaactttagcagcagagtacgtcaaaattggtaaaatttctcgtgcaggtgccgtattt
gcacaagttgcctcaatgaaagaagttcccgcaaataaaacatccgtatcttggatttca
tctcaaatagaattcaatttaagatactcagaatatttagctataactgaaaatcatgag
aaaagtataatggcttataatgatgcattcgtactcaaagagctactcgattcaacgatt
gaaaaggactcccaaaagaatccattatctcgtacacttcaatgtgagcgtgttgcaatt
gcggctagtgtttattcgaagatcgcatattatcgtgaagacgtaccaactacactgaaa
tatctagctcaagcacttagattatataataatgcagctcgacatatatcaaaacttaca
ccaaagagagaatcaagatctatgagagatgacaatgatcccttctcaatggaggtagat
gaacctaatgaaagtcaaagttcaccacacttgaatgtatttgaaaataggaagtgtact
ggtattcattggagaatatctcaatcattattagattgcttgatattgttgtcttcgatc
tatactagtagagggtcatcaagagaagctgaattctttttaggacaagcaaataatcta
acggaaacgctagcatcacccaactttgacgcgaagattaatgcagcgaaagcagagctc
aatctagcactaaacgacttagatcagtcaaagaaagatattgataaagcattatattcg
ttaggaggtcaagatgatacggaatcatccgttttaataaagaaagctaaaggagacttg
cagtttagattagaatcaaatgctgatgcatccgctggttatttatcagcttgtttaata
ttagaacgtttggataaagtatacaatgaaatagagacatcaactacatcaccgaagaag
tcaaacaatgatttcgtaaatgatgcaacaatttatgatccaattttaccagagatattt
ggacatctccttcgtcaaagaatttggttattgagtgaagatgaaaagaacgcagaaagt
caaaaattacttgacaagttgtttaatttccctacaaattcaataaataaagcggaagag
aatcttttattaggtaaaatgaggttaagagaggcttacaatagttttcaaagtgactta
tttatgtcttccttatctgatgctctgatttctgtaccttgtggttcagttgttaatggc
catgattctaactccctcaattcacgtcaaccaagtatagaaacattggcagatgcagaa
aagttctttatgagtgcacttgaactaaatattgataagacctcaataaaggatatacgt
caagcatgcttaggaatcgcgttaataaaatcatttcaaacctctctaggcaaagtcagt
aaaaataactcgagattagcagcaacgtatttagatttgggatctgctgtaactttacgt
agagagctattagaagtaattgacaataaattgtcacattctgagtcaaggaatgatatg
gattggcctggaattgatcagttgaatcaaataaagtcattatcaccacataagagaaat
tcaaaacgattgtttataccttcaccttcgccattaggttcaccaatgcatgaaagtgaa
aatttatttaacgaggatttgtcaataaataaatattgggaagatattaagtcgagacat
ttacgtgaattcaataaccctgaagaagggttagtagaaactataaatcaattaccaaac
aattattcagtaatatcgatttcaattacggatgataaaaagacaatgttcgttgttaaa
tttcgtaaaaattctgaaccattactggtttccttaccactggataatagacaaaataaa
cgtgaaggtggtggtgaagaaggtgcattcacatatcgagacgcaatagacgaattacaa
agtattatagaagaaagtgataaatctattaaatccgcaagtgatggccaagttataact
gatgatgacaaagtagattggtggaattgccgtaaacatttggattccagaatgagacaa
tttgttaagaatattgaattttgctggttaggtgtattcaaaagtttattcttaaaacca
acagctaaaagtgagaatgcattgaatggtttaagaggatgtttagagaaggttttcaaa
agacatatacattcaaatggtagaaaaagattaaattccaaagtcaaactggatgatgca
ctcttagaatgtttctcagctttgcaaactaattgcaaagatgaggaattagaagatcta
atttacttcgttttagatattcatggtttccacggtatacagttagcactagctgaaatt
gatattgatcaagcaacagttgatatacgtagcgcattagaagaatatagtaataagttc
tctgatgataatcaagtagaggatgaccaacatactttcatcatcttggataaaatgact
caaacaatgccatgggaatcaataccaactttgagaaatcagagcgtttctagaatccct
tcaattggatttttaagagataggatggacttaataaagcaccttcatcaagataaattc
tatgttaacccgaagaagacgttttgtttgattaatccatctggggatttaaagcgtaca
caaaagaacttcgaggggtggtttacgaaacttaaagaaattggttggaaaggtattacc
ggcagagaaccacttgaagttgaaattgcaaatgcactagaaacgaatgacttatttata
tactttggtcatggtggtggtcaaaaatacattaggtcacagaagatacgtaacctcaag
aaatgtgctacaacgatgttatggggatgttcttcaggctctttgaaatctactggcgac
tttgattcttatggtaatccaacgaattatttgctagctggttgtccatctttggtagct
aacttatgggatgtaactgatagagatattgatagattatctcaaagcgtttttgataaa
ttgggattgaattatgattcaatttctaataataagtgtcaagatagtattacaataaca
gaggcaatagcaagctcgcgtaaggactgtagactaaagtatctcactggttcagccgtt
gttgtttatggaataccaatccaattaagatag

DBGET integrated database retrieval system