KEGG   Wallemia mellicola: WALSEDRAFT_61194Help
Entry
WALSEDRAFT_61194  CDS       T03142                                 

Definition
(RefSeq) MT-A70-domain-containing protein
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
wse  Wallemia mellicola
Brite
KEGG Orthology (KO) [BR:wse00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:wse03019]
    WALSEDRAFT_61194
Enzymes [BR:wse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     WALSEDRAFT_61194
Messenger RNA biogenesis [BR:wse03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     WALSEDRAFT_61194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 DUF2967
Motif
Other DBs
NCBI-GeneID: 18474386
NCBI-ProteinID: XP_006959958
JGI: Walse1_61194
UniProt: I4Y7T7
Position
Unknown
AA seq 500 aa AA seqDB search
MISSEGDALLRYHVMKRNNEEEYLAKLPEDKKQKRKVYGQRYSLTDEESIRNDYSMAYVN
QLVRPQDQIINPHREGRFAEYPRQKQLLKLKDSLVEEYAYPPVYLPFDLVDAIPKSPTTP
SSLFDAIDIGTKFDVIMIDPPLPNSRSSKLEGRQWTWDALATLPIRNLSADPSFVFVWVG
SGGEDGLEKGRELLAKWGFRRAEDIIWVETTPEGHKEEDTSDVPDNLFKRTKQHCLMGIR
GTVRRALDSHFVNCNIDVDTIIAESASRKPSELMALIETFCLGTRRLCLFGEPENARRGW
LTVGMKGSNNETYSPPEGVDMFDSKQWSERFPNNKANLVPLTPEIDSLRPKSPNRSNNNS
RNGTPKSDPRTPPFATRPVGSPYGTPPNMPYNPQFNAQMRYHMQQQMQQQMQQQVQLQIQ
MQLQMQAQQAHMQMFGGGNLYQGVQAVPQMYYPPVNTTGTIYPLSPQMPISLGFDGNTNN
RRHAKTPSNSNQNNINRNRN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgtcagagggagacgctcttctgagatatcatgttatgaagagaaataacgag
gaggagtatttagcgaaacttccagaagataagaagcaaaagagaaaggtttacggccaa
cgctatagcttgacggatgaggaatccatccggaatgattacagtatggcatacgtaaac
caactagtgagaccacaagatcagattataaatccacatagagaaggtagattcgctgag
tatccacggcagaagcagctactcaagctgaaggatagtttagtagaggagtacgcttac
ccaccggtatacctaccatttgatttggtggatgctataccgaaatctccaacaacaccc
tcatctttatttgacgctatcgacattggtaccaagtttgacgttatcatgattgatcca
ccgttaccaaattcacgatcatcgaaattggaaggcagacagtggacctgggatgccttg
gctactcttccaatcaggaacctctccgctgaccctagtttcgtctttgtctgggttggt
agtggaggcgaagacggtctcgaaaagggaagagaattgcttgctaagtggggcttccgg
agggccgaggatattatctgggttgaaactactccagagggtcacaaggaggaggacaca
agtgatgtccctgataacctcttcaaacgcacaaaacaacactgtttgatgggtattaga
ggcacagtgcggcgtgcattagattcacactttgtgaactgcaatatagatgtcgataca
atcatcgcagagtcagcaagtcgtaaaccatccgagctgatggcacttatagaaacattt
tgtttgggtaccagaagattatgcctcttcggcgaaccagagaatgctcgcagaggatgg
cttaccgtcggcatgaaaggatctaataatgagacatatagtccaccagagggtgttgat
atgtttgacagtaagcaatggtcagagcgttttccaaataacaaagcaaatttggttcca
ctgacgcctgaaatcgacagcttacgaccaaaatcaccgaatcgttcaaacaacaatagt
aggaatggaactccgaaatctgatccccgcacgcccccatttgcgacacgtcctgtgggt
tctccatatggtacaccaccgaacatgccatacaatccacaatttaacgctcaaatgcgt
tatcatatgcaacagcagatgcagcaacaaatgcaacaacaagtgcagcttcaaatacaa
atgcagttgcaaatgcaggcacaacaagctcacatgcagatgtttggaggcggtaatctt
taccaaggtgtgcaagcagtaccacaaatgtattatccgccagttaatacgacgggaacg
atctatccattgtcaccgcaaatgccgataagtttaggatttgacgggaacacgaacaat
agaagacacgcaaagacgccatcaaacagcaatcagaacaatataaatcgcaacaggaac
taa

DBGET integrated database retrieval system