KEGG   Wallemia mellicola: WALSEDRAFT_64384Help
Entry
WALSEDRAFT_64384  CDS       T03142                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
wse  Wallemia mellicola
Pathway
wse00260  Glycine, serine and threonine metabolism
wse01100  Metabolic pathways
wse01110  Biosynthesis of secondary metabolites
wse01130  Biosynthesis of antibiotics
wse01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:wse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WALSEDRAFT_64384
Enzymes [BR:wse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     WALSEDRAFT_64384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 18474920
NCBI-ProteinID: XP_006958461
JGI: Walse1_64384
UniProt: I4YBT9
Position
Unknown
AA seq 377 aa AA seqDB search
MRNIIRTITTNARRLESLGRDFRTDTITAPTDEMLAYSVKHSSRGDDVYGEDESTSNFEK
KIAKMTGKPAAMFCVSGTMSNQIGLRTHLHQPPHSVLCDAHAHIYKYEAGGLAFHSQAQI
TPVEPTNGHHLQLNDIQAHATLEDDIHYAPTRIISLENTKNGLVFPQSETKKISEWASSN
NLIMHLDGARIWNVSAATGLSIDKLCQPYDSVSLCLSKGIGAPIGSILVGSEKVITKAKW
FRKLFGGGIRQSGFLAEAADFALENHFPLLPKTHERAKRIAEGFEQAKIRIISPVETSMV
FFDSSTIGFSLEEFIQRVKDRAGITISSNRIVVHHQITDEAVENLVQVAIEMSQEKRNPL
SSAIGQFGQIYQRFKTN
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacattatacgaacaataacgactaatgcacgtagactggaaagtcttggacgc
gatttcaggaccgacacgataacagcaccaactgatgaaatgcttgcgtattccgtcaaa
cactctagccgtggtgatgacgtttatggcgaggatgaaagtactagtaactttgagaag
aagattgcgaagatgactggtaaacctgctgctatgttttgcgtctctggtactatgtct
aatcaaattggattgcgcacccatttgcatcaaccaccacatagcgtactttgcgatgca
cacgctcatatctacaagtatgaagctggtggtcttgctttccattctcaggcacaaatt
acaccagttgagcccacaaatgggcatcatttacagcttaatgatatacaagcccatgcg
acactcgaagatgatatacattatgctccaacccgtataattagtcttgaaaataccaag
aatggtctggttttcccacaaagtgaaacaaaaaagatatctgaatgggcgtccagcaac
aatttgattatgcacctcgatggtgcgcgcatatggaatgttagcgcagctacaggttta
tctatcgataaactttgccagccatacgatagcgttagtctctgtctaagcaagggtatt
ggtgcacctattggttccattcttgtcggaagtgaaaaagtaatcacaaaggcaaaatgg
tttagaaagcttttcggtggtggtatccgtcaatctggatttcttgcggaggctgctgac
tttgctctcgagaatcatttcccacttttaccaaagacgcacgaacgagctaagagaata
gcagagggcttcgaacaagctaaaattagaattatatcacctgttgaaacatccatggtt
ttctttgatagctcaacaattggattcagccttgaggaattcattcaacgcgtcaaagat
cgggctggaataacgattagttccaacagaatagtcgtacaccatcaaattactgatgaa
gctgttgaaaatcttgttcaagtcgcaattgagatgtcacaggagaagagaaatccattg
tcatcagcgatcggacaatttggtcaaatttaccagcgtttcaagactaattag

DBGET integrated database retrieval system