KEGG   Wallemia mellicola: WALSEDRAFT_64491Help
Entry
WALSEDRAFT_64491  CDS       T03142                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
wse  Wallemia mellicola
Pathway
wse00052  Galactose metabolism
wse00500  Starch and sucrose metabolism
wse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    WALSEDRAFT_64491
   00500 Starch and sucrose metabolism
    WALSEDRAFT_64491
Enzymes [BR:wse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     WALSEDRAFT_64491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 18474932
NCBI-ProteinID: XP_006958565
JGI: Walse1_64491
UniProt: I4YC51
Position
Unknown
AA seq 492 aa AA seqDB search
MNRANGRDNNQCFGSSTGKPLSEDTYDETLRPQLHHTPSENFMNDPNGLVYANDVYHLYH
QWNDKDNIPGYQNWGHATSEDLVHWQLHPPAITPDSDDGPFIISGSAVVDEHNTSDLFNE
STTPSNRGVVTDTKHCSLNRWRFRDPKAFWYEQDSKWVMLVALASQHQMIIYESRNLIDW
FETSRFGNAGQPGYEYECPDLFPLEVEDTDEVRWVLITYVNPGAIRGGGSGTSYFIGDFD
GKTFTPIDTSIREMDFGYDDYAGVTFNNVPDGRRLWIGWASNWLYTGVVPTEPWRSSLTL
VHELSLTRANITDQHQSLTLRHKPVDLSSLISDTVKETNSPMKPDSIDFPTDGAVDMSID
VAFSSDTESSELSKSASRITIESEDGVNSIEFGVQFADHIVYINRANSGWSSPTFGSLGA
TSSNIPNNNKVKLRAVIDRSQIELFVQDRIHFASMVFFFQEGRVPARLRYENDEGVMIDH
LKLDALKSIWEC
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagcaaatggacgagataacaatcaatgttttggaagttcgacaggaaagcca
ttatctgaggacacctacgatgagacccttagaccacaactacaccacactccttctgag
aatttcatgaatgatcccaatggtttggtctacgccaacgacgtctatcatctgtaccat
caatggaatgataaagataatataccaggatatcaaaattgggggcatgctacgagcgaa
gacctcgtacattggcaattgcatcctcctgctatcacaccagacagtgatgatggacct
ttcatcatatcaggaagtgcagtcgttgatgaacataatacgtctgacctattcaacgaa
tcgacgacaccttcaaacagaggcgtcgttacagacacaaagcattgctcactcaacaga
tggaggtttagagatccaaaggcattctggtatgaacaagactctaagtgggtaatgcta
gttgctttggcttctcaacaccagatgattatttacgaatcgagaaacctgatagactgg
tttgagacatctaggttcggaaacgccggtcaaccaggttatgaatacgagtgtccagac
cttttcccactcgaggtagaagataccgatgaggtcagatgggttttaataacatatgta
aacccaggtgctattcgcggtggtggatcaggtactagctactttattggcgatttcgac
ggcaaaacatttacaccgatcgatacatcaatcagagaaatggacttcggctatgacgat
tatgcaggtgttactttcaataatgtaccagatggtcgtagactatggattggatgggct
agcaattggctctacactggtgtcgttccaacagagccgtggagatcatctctgacactc
gttcatgaattgtcactcacgcgagccaatataactgaccagcatcagtctttaacactc
aggcataaaccagttgatctttcaagtctcatctccgatactgtcaaagaaacaaattcc
ccaatgaaacctgactcgattgattttccaacagatggtgcagtcgacatgtcgatcgat
gttgcattttcatcggatacagagtcatcagaattgtcaaagtcagcatcgcgtatcacg
atcgaaagtgaggatggtgtaaactccattgagtttggtgttcaatttgccgatcatatc
gtttacattaacagagctaactctggttggtcttcgccaacatttggttctctcggtgca
acttctagtaatatcccaaataacaacaaagttaaactaagagcagtaattgatcgctcc
caaattgaattattcgtccaggaccgtatacacttcgcttcaatggtcttttttttccaa
gaaggtcgtgtacctgcacgcctacgctacgagaatgatgaaggagtcatgatcgatcat
ctcaagttagatgctttgaagagtatttgggaatgttga

DBGET integrated database retrieval system