KEGG   Weissella soli: WSWS_01205Help
Entry
WSWS_01205        CDS       T06066                                 

Gene name
ggpS
Definition
(GenBank) Dimethylallyltranstransferase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
wso  Weissella soli
Pathway
wso00900  Terpenoid backbone biosynthesis
wso01100  Metabolic pathways
wso01110  Biosynthesis of secondary metabolites
wso01130  Biosynthesis of antibiotics
Module
wso_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:wso00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WSWS_01205 (ggpS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:wso01006]
    WSWS_01205 (ggpS)
Enzymes [BR:wso01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     WSWS_01205 (ggpS)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     WSWS_01205 (ggpS)
    2.5.1.29  geranylgeranyl diphosphate synthase
     WSWS_01205 (ggpS)
Prenyltransferases [BR:wso01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   WSWS_01205 (ggpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AOT56814
Position
complement(1235977..1236837)
Genome map
AA seq 286 aa AA seqDB search
MNLAAFMAKVQPAIEENLAEQLTTASQLPALAEAMNYSVMNGGKRLRPALSLAVLADLGL
AWQNYLTEVSAVELVHTYSLIHDDLPAMDDDDLRRGQPTSHKVYGEALAILAGDALQPLA
YQWLAQSELLSAGQKSELMLQLAQASGADGMVAGQVADMAATAAETITLEQAMAIHYRKT
GALLGYAAVAGGIIGQTNEDALSLLWDFGMTYGLAFQIKDDLDDLAQDDTEDKQSYPYLL
GVTGAQQALQQQVTLAQEQVDGLQTLTGHSMQQLNAFLAYFKDEME
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaacttagcagcatttatggctaaagtacagccggccattgaagagaacttggctgaa
caattaacgacagccagtcaattaccagccctcgctgaagcgatgaattattctgtgatg
aatggtggtaagcgactgcgaccagctttatcgttagctgtgctagcagatttagggctg
gcttggcaaaattatttaactgaggtcagcgccgttgaattagtccacacctatagctta
atccatgatgatttaccggcaatggatgatgatgacttacgcagaggtcagccgaccagt
cataaagtgtacggtgaggcgttagcaattttagctggggatgccctacaacctttggcg
tatcaatggttggcgcaaagtgaactcctttcagcagggcaaaagtctgagctgatgtta
cagttggcacaggcgagtggtgctgatggcatggtagctggtcaagttgcagacatggca
gcgaccgctgctgaaaccatcaccctcgagcaagcaatggccattcattatcgtaaaact
ggcgctttgctcgggtatgctgccgttgctggcgggattatcggccaaacaaacgaggat
gccttgagcttactctgggatttcgggatgacctatgggttggcttttcaaattaaagat
gacttagatgatctggcccaagatgataccgaggataagcaaagttacccctatctcctg
ggagtgactggtgcgcaacaagcgttacaacagcaggtcacgttggcccaggaacaggtg
gatgggttacagactttaactgggcactcgatgcagcagctgaacgcgtttttagcatat
tttaaggatgaaatggagtaa

DBGET integrated database retrieval system