KEGG   Wolinella succinogenes: WS0157Help
Entry
WS0157            CDS       T00146                                 

Gene name
ACCD
Definition
(GenBank) CARBOXYLASE CARBOXYL TRANSFERASE
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00061  Fatty acid biosynthesis
wsu00620  Pyruvate metabolism
wsu00640  Propanoate metabolism
wsu01100  Metabolic pathways
wsu01110  Biosynthesis of secondary metabolites
wsu01120  Microbial metabolism in diverse environments
wsu01130  Biosynthesis of antibiotics
wsu01200  Carbon metabolism
wsu01212  Fatty acid metabolism
Module
wsu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:wsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WS0157 (ACCD)
   00640 Propanoate metabolism
    WS0157 (ACCD)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    WS0157 (ACCD)
Enzymes [BR:wsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     WS0157 (ACCD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     WS0157 (ACCD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans MdcE
Motif
Other DBs
NCBI-ProteinID: CAE09320
UniProt: Q7MAM0
Position
complement(160381..161250)
Genome map
AA seq 289 aa AA seqDB search
MGFADFFKTFTRERAKEGESPSHWIKCPSCSALMYYKEVIAQHHVCPKCNFHMRIALEDR
IEMLCDEGTLIEHDASLEPTDPLTFVDKKSYKKRIEEGKQKTGRASSVLSGECRINGVST
QIVLFNFAFMGGSLGSVEGEKIVRAVNRALEKHQGLVILSTSGGARMQESTYSLMQMAKT
SAALARLSQAKLPFISLLTDPTMGGVSASFAFLGDIIIAEPGAMVGFAGARVIKQTIGAD
LPEGFQTAEFLLEHGLIDMITPRKEMKKTLGDLLRFFNPYDENPCLLHL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgggttttgccgacttttttaaaaccttcactagagaacgcgccaaagagggggaatcc
cctagtcactggatcaaatgccctagttgtagcgccctcatgtattacaaggaggtgatc
gcgcaacatcatgtctgccctaagtgcaacttccatatgcgcatcgccctcgaagatcgc
attgagatgctctgcgatgaggggactctcattgagcacgacgcctccctagagcccact
gatccgctcacttttgtagacaagaagagctacaaaaaaagaatcgaagagggaaaacaa
aaaacagggcgcgccagctctgttctaagcggagagtgtcgaatcaatggggttagcacc
caaatcgtgctctttaactttgcttttatgggaggaagccttggctcggtggagggtgaa
aaaatcgttcgcgcggtcaatcgtgccctcgaaaaacaccaaggactcgtgattctcagc
actagcggaggcgctagaatgcaagagagcacctactctttgatgcagatggccaagaca
agcgcggctttggcgcgactctctcaggccaagcttccttttatctctctcctcactgat
cctaccatggggggcgtgagcgcctcttttgcctttttgggcgatatcattatcgccgaa
cccggagccatggtaggctttgctggagcgagggtcatcaaacagaccattggagcggat
ctgcctgagggcttccaaacggcggaatttttgcttgagcatgggctcattgacatgatc
accccacgcaaggagatgaagaagaccttgggcgaccttttgagattcttcaacccctac
gatgaaaatccgtgtctattgcatctctaa

DBGET integrated database retrieval system