KEGG   Wolinella succinogenes: WS0611Help
Entry
WS0611            CDS       T00146                                 

Definition
(GenBank) OCTAPRENYL-HYDROXYBENZOATE CARBOXYLYASE
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00130  Ubiquinone and other terpenoid-quinone biosynthesis
wsu01100  Metabolic pathways
wsu01110  Biosynthesis of secondary metabolites
wsu01120  Microbial metabolism in diverse environments
wsu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:wsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    WS0611
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    WS0611
Enzymes [BR:wsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     WS0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: CAE09742
UniProt: Q7M9X3
Position
599198..599728
Genome map
AA seq 176 aa AA seqDB search
MKKLTVALSGASGIELGWKLIEAIPKEIELFVVATEGAFVVAQREGVRRDFRALEDSDIG
ACIASGSFGCDAMAIVPCSLNTLAKIAHGIADNLTTRAASVMLKEQKRLLLAPREMPFGA
IMLENMLKLSRLGVMISPPVAGYYAGIETLEMMEDFWVGKWLDGLGIAHELYQRWK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcttacggttgccctaagcggtgcaagtggaatcgagctgggctggaagctc
atcgaggccatccctaaagagattgagctctttgtggtggccacagagggggcttttgta
gtggcccaaagagaaggggtgaggcgcgactttagggcgctagaggatagcgacattggg
gcgtgtattgcctcaggttcctttggatgcgatgcgatggcgattgtgccttgtagtctg
aacacactcgccaagattgcccatggaatcgccgacaatctcactacaagagcggcaagc
gtgatgctcaaagagcaaaagcgcctgctccttgcccccagagagatgccctttggcgcg
atcatgctggaaaatatgctcaagctctcgcgccttggcgtgatgatctctccgcctgtg
gcaggctattatgcagggattgagacgctagagatgatggaagatttttgggtgggcaag
tggcttgatggcctaggaatcgcccacgaactctaccaaaggtggaaataa

DBGET integrated database retrieval system