KEGG   Wolinella succinogenes: WS0843Help
Entry
WS0843            CDS       T00146                                 

Definition
(GenBank) PUTATIVE SIGNAL TRANSDUCTION PROTEIN
  KO
K03406  methyl-accepting chemotaxis protein
Organism
wsu  Wolinella succinogenes
Pathway
wsu02020  Two-component system
wsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:wsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WS0843
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    WS0843
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:wsu02035]
    WS0843
Bacterial motility proteins [BR:wsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    WS0843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal 4HB_MCP_1 TarH CHASE3 DUF948 HAMP Collagen_mid Flu_M1_C
Motif
Other DBs
NCBI-ProteinID: CAE09954
UniProt: Q7M9K9
Position
798976..800661
Genome map
AA seq 561 aa AA seqDB search
MGWIQDWKVRTKIVVIVTVFALVAGGIGWRGLSGADLLNSSITTIVQVNVPRIAESQSLL
VNLLQLQRTEKNHILSESQEQLEQRERNYRKKEEEIAKQLKLLEGLVSEQNRIKVKECAE
SFKKYSQTVEKVLELSRAGMNDQATKISQNEARIHMDRCEELMEQIVASNEENLSITDKE
TNELYEGMRYSILVIIIVGLAIAFLMSMLVIKNITHALALVKSGLLSFFSFLSRESKEAQ
LINLSSKDEFGEMAGAINENIKRIQKGLLEDTETVQETLMVVNRIKEGHLNQAIHSLPDN
PQLLKLKELLNEMLASLNQNFQGVLSLLKSYAENDFRERMEKGGLKGEVASLIEGVNYLG
GEITKMLQSSLDSGHSMEKQARLLQESMEVLSQGANEQAASLEESAAAIEEMSSSMGGIS
HRAEEVSKQTEEIRNVIMIIRDIADQTNLLALNAAIEAARAGEHGRGFAVVADEVRKLAE
RTQKSLGEIEANTNVLVQSVNEMSDSIKEQAQGITQINEAIAQLDTVTQQNAGVADKTDG
IAREVSKMAEGMVEEVRKKRF
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgggatggattcaagattggaaagtgagaacaaaaatcgtcgttattgtaacggttttt
gcgctggtggcggggggtattggctggcgggggttatcaggggcggatcttttgaatagc
tctatcacgaccattgtgcaggtgaatgttccaaggatagccgaatcgcaatccttgctg
gttaatctgctgcaactccaaagaacagagaagaatcatatcctctctgagagccaagag
cagctagagcagcgtgagagaaactatcgcaaaaaagaggaagagatcgccaagcaacta
aagcttttagagggattggtgagtgagcagaatcggataaaagtcaaagagtgcgccgag
tcattcaaaaaatatagccagaccgtcgagaaggtcttggagctctcaagggcggggatg
aacgatcaagcgaccaaaatttctcaaaatgaagccagaatccacatggatagatgcgag
gagctcatggagcagattgtcgcctctaacgaggagaatctctccatcaccgacaaagag
accaatgagctctatgaggggatgaggtatagcattttggtgatcatcatcgtggggttg
gcgattgcctttttaatgtcaatgcttgtgattaaaaatatcactcacgcactcgcccta
gtcaaatccggcctcctctccttcttctctttcctctcaagagaatccaaagaggcacag
ctcatcaatctctcctctaaagatgagtttggagagatggctggagcgatcaatgaaaac
atcaagcgtatccaaaaagggttgctagaggacacagagaccgtccaagagactcttatg
gtggtcaatagaatcaaagagggtcatctcaaccaagccatccactccctccctgataat
cctcagctcctcaaactcaaagagcttcttaatgagatgcttgcctctttgaatcaaaac
ttccaaggagtcctctctcttctaaagagctacgctgagaatgactttagggagaggatg
gaaaaaggaggactcaaaggagaagtcgcctctttgattgaaggggtcaactatctagga
ggagagatcactaagatgctccaaagctctcttgattcaggacactccatggagaaacag
gccagactcctgcaagaatcaatggaggttctctctcagggagccaacgaacaagccgcc
agcctagaagagagtgccgccgctattgaagagatgagtagctctatgggaggaatcagc
catagagctgaagaggtctctaaacagactgaagagattcgtaatgtcatcatgatcatt
agagacattgccgatcaaaccaatctactggctctaaatgctgccattgaagccgcaaga
gcaggagagcatggaagaggatttgcagtcgttgccgatgaagtgagaaagctagcggag
agaactcagaagtctttaggagagatagaggccaataccaatgtcctagttcaatctgtc
aatgagatgagtgatagtattaaagagcaagctcaaggaatcactcagatcaatgaagcc
attgcccaacttgatactgtaacccaacaaaatgcaggagtagcggataagacggatggg
atagctagagaggtctctaagatggcagaggggatggttgaagaggtgaggaagaagagg
ttttaa

DBGET integrated database retrieval system