KEGG   Wolinella succinogenes: WS1751Help
Entry
WS1751            CDS       T00146                                 

Gene name
HEMN
Definition
(GenBank) OXYGEN-INDEPENDENT COPROPORPHYRINOGEN III OXIDASE
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00860  Porphyrin and chlorophyll metabolism
wsu01100  Metabolic pathways
wsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    WS1751 (HEMN)
Enzymes [BR:wsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     WS1751 (HEMN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C Fer4_14
Motif
Other DBs
NCBI-ProteinID: CAE10773
UniProt: Q7M8B6
Position
complement(1647379..1648746)
Genome map
AA seq 455 aa AA seqDB search
MIDFEKFARYSKAGPRYTSYPTANEFHEGFGEKEYREALRREDPAKALSLYIHLPFCRSA
CYFCGCNVIYTSKEDKKERYIGYLKKELALLKEAMDTHREVTQLHFGGGTPTFMDASQLA
EILDLLHETFPRFSDDAELSCEIDPRFFTQEQMQALKRGGINRLSFGVQDFNPGVQEAIH
RTQSVELVARAVEMARAHGINSINFDLIYGLPYQDFESFAKTLEEVVKLSPDRLAVFNYA
HVPWMKKTMRKIDETTLPSPKEKLKILEHTIGFLQNSGYETIGMDHFAKREDELFKAIEK
GELRRNFQGYTTKGKSQTIGIGLTSIGEGSDYYAQNHKEMEAYERALDEGHLPIHKGILL
SEDDRLRKEVIMSLMSNFKLAFAPLNERYGIDFKSYFAEALEELKEYEEAGLLELNEEGI
AVSPTGTMLIRNIAMPFDAFLKKSPLSERKFSKTV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgattgattttgaaaagtttgcccgctactccaaagcaggccctagatacaccagctat
cccaccgccaatgagtttcatgaaggctttggtgaaaaagagtatagagaggccttgcgg
agagaagacccagccaaagcgctttcactctatatccacctccctttttgtcgaagcgcc
tgttatttttgcggttgcaatgtcatctacaccagcaaagaggataaaaaagagcgctat
attggctatctcaaaaaagagcttgccctgctcaaggaggcgatggatacgcaccgtgag
gtgacccagctccactttggtgggggcacccccaccttcatggatgcttcccagctcgca
gaaatccttgatcttctccatgagacttttccccgattcagcgatgatgcagagcttagc
tgtgagatcgaccctcgattcttcacccaagagcagatgcaagcactcaaaaggggagga
atcaaccgtcttagttttggggtgcaggactttaaccctggtgttcaagaggcgatccat
cgcactcagagtgtcgagttggtcgctagagcggtggagatggctagagcgcatggaatc
aactctatcaattttgacctcatctatggcctcccctatcaagattttgagagttttgcc
aaaaccctagaagaggtggtgaagctctcccctgatcgcctcgcggtctttaactatgcg
catgtgccttggatgaaaaagaccatgcgaaagattgatgagaccacgcttccctccccc
aaagagaagctcaagattttggagcacacgattgggtttcttcaaaatagcggctatgag
accatcggaatggatcactttgccaagcgcgaagacgagctctttaaggcgattgaaaaa
ggggagctcaggcgaaatttccaaggctacacgaccaaaggtaaaagccagacgatagga
atcggcctcacctctattggggaagggagcgactattacgcgcagaatcataaagagatg
gaggcctatgaaagggcgctggatgagggacatctccctatccacaaaggaatcttgctc
agcgaagatgatcgattgcgcaaagaggtgatcatgagcctcatgagtaacttcaagctc
gcctttgccccccttaatgagcgctatggaatcgattttaaatcctactttgccgaggcg
ttagaagagctcaaagagtacgaagaagcggggcttttggagctcaacgaggagggaatc
gcggtctctcctacaggaaccatgctcattcggaatattgccatgccttttgacgccttt
ttgaaaaagagtcctctttcagagcgcaaattcagtaaaacggtgtga

DBGET integrated database retrieval system