KEGG   Wolinella succinogenes: WS2131Help
Entry
WS2131            CDS       T00146                                 

Definition
(GenBank) PYRUVATE FERREDOXIN OXIDOREDUCTASE, DELTA SUBUNIT
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00010  Glycolysis / Gluconeogenesis
wsu00020  Citrate cycle (TCA cycle)
wsu00620  Pyruvate metabolism
wsu00640  Propanoate metabolism
wsu00650  Butanoate metabolism
wsu00680  Methane metabolism
wsu01100  Metabolic pathways
wsu01120  Microbial metabolism in diverse environments
wsu01130  Biosynthesis of antibiotics
wsu01200  Carbon metabolism
Module
wsu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WS2131
   00020 Citrate cycle (TCA cycle)
    WS2131
   00620 Pyruvate metabolism
    WS2131
   00640 Propanoate metabolism
    WS2131
   00650 Butanoate metabolism
    WS2131
  Energy metabolism
   00680 Methane metabolism
    WS2131
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    WS2131
Enzymes [BR:wsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     WS2131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_7 Fer4_10 Fer4_6 Fer4_2 Fer4_4 Fer4_17 Fer4_9 Fer4_13 Fer4_16 Fer4_8 Fer4_15 Fer4_18 Fer4_3
Motif
Other DBs
NCBI-ProteinID: CAE11128
UniProt: Q7M7R4
Position
complement(2016036..2016428)
Genome map
AA seq 130 aa AA seqDB search
MNYKGWNEFEIGSLLFPFEKEGEKNVEKHAEERDYNSDNSYTASTAHWRVEKPVYNPEGC
IHCYFCWLYCPDSSILVRSEKMTGVDYVHCKGCGVCVSVCPTNPKSLLMFNDHESEEAAL
ASWPKKEEKK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
gtgaactacaaaggctggaatgaatttgaaattggttctctactctttccttttgagaaa
gagggtgagaaaaatgtcgaaaagcacgccgaagagagagactataactccgataactcc
tacacggcaagcacagcgcactggcgcgtagagaagcctgtttacaatcctgagggctgt
attcactgctacttctgttggctctactgccccgattcttcaattttggtgagaagcgag
aagatgacaggcgtcgattatgtgcattgcaaaggctgtggtgtttgcgtgagcgtctgc
cccaccaaccctaagtcccttttgatgtttaacgatcacgagagcgaggaggcagccctt
gcttcttggcctaaaaaagaagagaaaaagtaa

DBGET integrated database retrieval system