KEGG   Weeksella virosa: Weevi_0171Help
Entry
Weevi_0171        CDS       T01441                                 

Definition
(GenBank) 3-oxoacid CoA-transferase, A subunit
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
wvi  Weeksella virosa
Pathway
wvi00072  Synthesis and degradation of ketone bodies
wvi00280  Valine, leucine and isoleucine degradation
wvi00650  Butanoate metabolism
wvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Weevi_0171
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Weevi_0171
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Weevi_0171
Enzymes [BR:wvi01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Weevi_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: ADX66895
UniProt: F0NXC1
Position
163167..163880
Genome map
AA seq 237 aa AA seqDB search
MINKKVNSIEEALAGVESGMTLAIGGFGLSGIPENLIQGMVQKKINNLTCISNNAGVDDF
GLGLLLQNRQIKKMISSYVGENAEFERQMLSGELEVELIPQGTLATRLMAAGYGMPAIFT
PAGVGTEVAEGKETRKFTFHGIEKEYLLEYAFEPDFAIVKAWKGDTAGNLIYRGTSNNFN
HPVAMCGKITIAEVEELVEPGELDPSQIHTPGIFVHRIIQGEKYEKRIEQRTTLPRK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaaaaagtaaacagcatcgaggaagctttggccggtgtagagagtggcatg
accttagcaatcggtggatttggtttatcgggaattccggaaaacttgattcaaggaatg
gtgcaaaagaaaatcaataatcttacatgcattagcaacaatgcgggagtagatgatttt
ggattaggtttattactacaaaacagacaaatcaagaaaatgatttcttcttatgtagga
gaaaatgcagaattcgaacgccaaatgttatcgggggaattagaagtggaactcatcccg
caaggaacattggcaacacgtttaatggcggcgggttacggaatgccagctatttttacg
cctgcaggtgtaggtaccgaagttgcagaaggtaaagagacccgaaaatttacttttcat
gggatagaaaaagagtacttgctggagtatgctttcgaaccagattttgcaatcgtcaaa
gcttggaaaggagatacagcaggaaatttaatttatcgtggaacctcgaacaacttcaat
catccagttgccatgtgtggtaaaatcaccattgccgaggtagaagaattggtagagcca
ggagaattggatccaagtcagattcatacaccagggatttttgtacaccgaataatccaa
ggagaaaagtatgaaaaacgaattgagcaacgcacaactttacctagaaaataa

DBGET integrated database retrieval system