KEGG   Weeksella virosa: Weevi_0382Help
Entry
Weevi_0382        CDS       T01441                                 

Definition
(GenBank) Hydroxymethylglutaryl-CoA lyase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
wvi  Weeksella virosa
Pathway
wvi00072  Synthesis and degradation of ketone bodies
wvi00280  Valine, leucine and isoleucine degradation
wvi00281  Geraniol degradation
wvi00650  Butanoate metabolism
wvi01100  Metabolic pathways
wvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Weevi_0382
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Weevi_0382
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Weevi_0382
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Weevi_0382
Enzymes [BR:wvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     Weevi_0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: ADX67101
UniProt: F0NYI1
Position
complement(366357..367199)
Genome map
AA seq 280 aa AA seqDB search
MKIIECPRDAMQGRKIFIPTQQKIDYLNALLDVGFDMIDCGSFVSPKAIPQMADTQEVLD
AIDKCSSTSKLSVVIANVNGAQKACDHEKVDVLGYTFSISENFQQYNTNKTREEAFAIAE
EIQELAHKHNKELMIYFSMAFGNPYKEAFDEELVLSWVNRFAKMGVKSINLSDTVGVADH
TIITDLFTTLIPAYQEIEFGAHFHTEYDKWYEKVDAAYLSGCRKFDGAIKGLGGCPMAKS
DMVGNMPTEKLISYANEKHAIHGLNLLNFESAYNQALKIF
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatagaatgtcctagggacgcaatgcaaggccgaaaaatatttatccctaca
cagcaaaaaatagactatctcaacgctttactcgatgtaggttttgatatgattgattgc
gggagctttgtttcaccaaaagcaataccacaaatggccgatacccaagaggttttggat
gcaatagataaatgcagcagtacctcgaaattatcagtagtaatagccaatgtaaatggt
gctcaaaaagcatgcgaccacgagaaagtagatgttttgggctatactttttctatcagc
gaaaattttcaacaatataataccaacaaaacaagagaggaagcttttgcaatagcagaa
gagatccaagaacttgcacacaaacacaacaaagagttgatgatttatttttctatggct
ttcggtaatccatacaaggaggcttttgatgaagagttggttttatcttgggtaaatcgt
tttgcgaaaatgggtgtgaaatctatcaatctatcggatacagtaggggtggcagatcac
acaatcataaccgatttgtttaccaccttgatacctgcttatcaagaaatagaatttgga
gcacacttccataccgaatacgataaatggtacgaaaaagtagatgctgcttatctcagt
ggctgtagaaagtttgatggtgcaataaaaggtttaggcggttgtccgatggctaaaagt
gatatggtaggaaatatgccaaccgaaaaattaatcagttatgccaatgaaaagcatgca
atacacggattaaatcttctgaatttcgaatctgcatacaaccaagcattgaaaatattt
tag

DBGET integrated database retrieval system